All posts tagged FEC
4/30/15 E&E Daily INTERIOR: ‘We’re terrified,’ rancher tells lawmakers about Park Service
Posted by Jane Gyorgy on April 30, 2015
https://oysterzone.wordpress.com/2015/04/30/43015-ee-daily-interior-were-terrified-rancher-tells-lawmakers-about-park-service/
08-21-14 GreenBiz wants examples of govt leaders actions to protect natural resources & my response
In a post today in Green Biz, Lizzie Needham,
wrote
Dear GreenBiz Group Member,
According to the Union of Concerned Scientists, deforestation accounts for 10 percent of global emissions—a big number when you consider that this equates to around 3.0 billion tons of CO2 per year. Tensie Whelan, President of the Rainforest Alliance, fights to reduce deforestation by advocating for biodiversity protection and sustainable agricultural systems.
In her recent GreenBiz interview, Whelan claims that we are seeing exponential progress, particularly within the business world, but crucial action still lags. Whelan’s interview also reminds us that while business cooperation makes a difference, impactful natural resource protection transformations rely on government support. You can read Whelan’s full interview here: http://grn.bz/1uYujYX
Do any members have unique or impressive examples of government leaders taking significant action to protect natural resources?
I responded:
Posted by Jane Gyorgy on August 21, 2014
https://oysterzone.wordpress.com/2014/08/21/08-21-14-greenbiz-wants-examples-of-govt-leaders-actions-to-protect-natural-resources-my-response/
07-27-14 TBOC et al v DOI et al Complaint for Declaratory & Injunctive Relief, Memorandum of Points and Authorities & Stipulation and Proposed Order re Briefing Schedule
Friends of Drakes Bay Oyster Company:
These documents, were not delivered to me for posting on www.OysterZone.org until today.
Please note, whereas, the retail and cannery will still be closing on 31 July, in the words of Yogi Berra – “It isn’t over until its over!”
Below, please find three recent filings:
- Brief Filed 07-17-14, a fuller title being Tomales Bay Oyster Co (and others) Plaintiffs, v. USDOI, USNPS, Jonathan Jarvis, NOAA office of Ocean and Coastal Resource Mgmt and Office of Ocean and Coastal Resource Mgmt, in the case of “Complaint for Declaratory and Injunctive Relief (20 pages)
- Memorandum of Points and Authorities in Support of Plaintiffs’ Application and Motion for a Temporary Restraining Order and Preliminary Injunction (29 pages)
- Tomales Bay Oyster Company et al. Plaintiffs v USDOI et al Defendants Case No: 3:14-cv-03246 YGR STIPULATION AND [PROPOSED] ORDER RE: BRIEFING SCHEDULE
Briefly,
- The First attachment, which I have named 07-17-14 TBOC et al vs DOI, is the “COMPLAINT FOR DECLARATORY AND INJUNCTIVE RELIEF” filed 07-17-14
- the Introduction brings us through vital points leading to the memorandum decision ordering the closure of DBOC
- the erroneous position taken by the DOI sweeping away any statute or regulation that might otherwise have applied
- the arbitrary, capricious and in violation of the law ignoring of procedural constraints that legally applied to this decision and failure to comply with them
- NOAA-OCRM’s arbitrary, capricious and in violation of the law determination order requiring a consistency certification to the CCC
- the plaintiff’s loss of critical components of locally harvested oyster supplies causing them to suffer irreparable losses of business and that Defendants’ procedural failures etc., were not adequately analyzed or considered
- the request the Court
- hold unlawful and set aside the decision to close DBOC and the NOAA decision requiring a consistency certification
- enjoin Defendants to engage in a decision making process that complies with the law
- In the interim, Plaintiffs seek a temporary restraining order and injunctive relief
- the Parties section, please pay particular attention to item 20, regarding Plaintiff Jeffrey Creque
- Who qualifications include
- a PhD in Rangeland Ecology,
- CA St Bd of Forestry Certified Professional in Rangeland management, a
- is a founding member and member of the board of ALSA, a citizens group dedicated to the preservation and enhancement of the natural environment and ecologically sustainable agriculture in Marin County.
- Who holds that encouragement of the cultivation of shellfish is an ecologically benign and even beneficial food production system fro environmental reasons including
- shellfish aquaculture, particularly oyster culture, is widely recognized as a carbon neutral or carbon beneficial source of highest quality marine protein
- shellfish aquaculture is a critical tool for the preservation and restoration of the world’s threatened marine ecosystems.
- all shellfish cultivated in Drakes Estero are sold locally thereby directly reducing the carbon costs of global food production and transport.
- ensuring that federal agencies adhere to national policies that call for increased – not decreased – shellfish production
- Who qualifications include
- the Facts section (pages 8-11, please read these yourself, they speak for themselves)
- the Causes of Action
- Count 1: Violation of the National Aquaculture Act and the APA (pg 11-13)
- Count 2: Violation of the CZMA and the APA (pg 13-15)
- Count 3: Violation of the APA (pg 15-16)
- Count 4: Violation of the CZMA and the APA (pg 16-17)
- Requested Relief (pg 18-19)
- the Introduction brings us through vital points leading to the memorandum decision ordering the closure of DBOC
The Second attachment, which I have named 07-07-14 TBOC et al vs DOI Memorandum of Points and Authorities in Support of Plaintiff Application and Motion.
- Read this (and all attached documents) in its entirety.
The Third Document, which I have named 07-24-14 Stipulation and Proposed Order RE: Briefing Schedule, briefly put stipulates:
- Plaintiffs withdraw their Application and Motion for a Temporary Restraining Order and Preliminary Injunction
- Plaintiffs intend to file a Motion for Preliminary Injunction before July 31, 2014 and Defendants shall file their Opposition on or before august 26, 2014; Plaintiffs shall file their Reply on or before September 2, 2014
- Request Motion be heard by the Court on September 9, 2014
- Plaintiffs’ may seek a preliminary injunction on shortened time, and will discuss adjustments to the briefing schedule accordingly.
For the complete documents:
07-17-14 TBOC et al vs DOI et al Complaint for Declaratory and Injunctive Relief
07-24-14 Stipulation and Proposed Order re Briefing Schedule
Posted by Jane Gyorgy on July 27, 2014
https://oysterzone.wordpress.com/2014/07/27/07-27-14-tboc-et-al-v-doi-et-al-complaint-for-declaratory-injunctive-relief-memorandum-of-points-and-authorities-stipulation-and-proposed-order-re-briefing-schedule/
07-10-2014 HOW TO CONTACT ANY CONGRESS PERSON
THE TIME FOR YOU TO RISE UP AND GET CONGRESS TO ACT TO REVERSE SALAZAR’S DECISION IS NOW!
http://www.house.gov/representatives/#state_ca
Directory of Representatives
Also referred to as a congressman or congresswoman, each representative is elected to a two-year term serving the people of a specific congressional district. The number of voting representatives in the House is fixed by law at no more than 435, proportionally representing the population of the 50 states. Currently, there are five delegates representing the District of Columbia, the Virgin Islands, Guam, American Samoa, and the Commonwealth of the Northern Mariana Islands. A resident commissioner represents Puerto Rico. Learn more about representatives at The House Explained.
Alabama
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Byrne,Bradley | R | 2236 RHOB | 202-225-4931 | Armed Services Education and the Workforce Natural Resources |
2 | Roby, Martha | R | 428 CHOB | 202-225-2901 | Appropriations |
3 | Rogers (AL), Mike | R | 324 CHOB | 202-225-3261 | Agriculture Armed Services Homeland Security |
4 | Aderholt, Robert | R | 2369 RHOB | 202-225-4876 | Appropriations |
5 | Brooks, Mo | R | 1230 LHOB | 202-225-4801 | Armed Services Foreign Affairs Science, Space, and Technology |
6 | Bachus, Spencer | R | 2246 RHOB | 202-225-4921 | Financial Services the Judiciary |
7 | Sewell, Terri A. | D | 1133 LHOB | 202-225-2665 | Financial Services Intelligence (Permanent) |
Alaska
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Young, Don | R | 2314 RHOB | 202-225-5765 | Natural Resources Transportation |
American Samoa
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Faleomavaega, Eni F. H. | D | 2422 RHOB | 202-225-8577 | Foreign Affairs Natural Resources |
Arizona
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Kirkpatrick, Ann | D | 330 CHOB | 202-225-3361 | Transportation Veterans’ Affairs |
2 | Barber, Ron | D | 1029 LHOB | 202-225-2542 | Armed Services Homeland Security Small Business |
3 | Grijalva, Raul | D | 1511 LHOB | 202-225-2435 | Education and the Workforce Natural Resources |
4 | Gosar, Paul A. | R | 504 CHOB | 202-225-2315 | Natural Resources Oversight and Government |
5 | Salmon, Matt | R | 2349 RHOB | 202-225-2635 | Education and the Workforce Foreign Affairs |
6 | Schweikert, David | R | 1205 LHOB | 202-225-2190 | Science, Space, and Technology Small Business |
7 | Pastor, Ed | D | 2465 RHOB | 202-225-4065 | Appropriations Intelligence (Permanent) |
8 | Franks, Trent | R | 2435 RHOB | 202-225-4576 | Armed Services the Judiciary |
9 | Sinema, Kyrsten | D | 1237 LHOB | 202-225-9888 | Financial Services |
Arkansas
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Crawford, Rick | R | 1711 LHOB | 202-225-4076 | Agriculture Transportation |
2 | Griffin, Tim | R | 1232 LHOB | 202-225-2506 | Ways and Means |
3 | Womack, Steve | R | 1119 LHOB | 202-225-4301 | Appropriations |
4 | Cotton, Tom | R | 415 CHOB | 202-225-3772 | Financial Services Foreign Affairs |
California
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | LaMalfa, Doug | R | 506 CHOB | 202-225-3076 | Agriculture Natural Resources |
2 | Huffman, Jared | D | 1630 LHOB | 202-225-5161 | Natural Resources the Budget |
3 | Garamendi, John | D | 2438 RHOB | 202-225-1880 | Agriculture Armed Services Transportation |
4 | McClintock, Tom | R | 434 CHOB | 202-225-2511 | Natural Resources the Budget |
5 | Thompson, Mike | D | 231 CHOB | 202-225-3311 | Intelligence (Permanent) Ways and Means |
6 | Matsui, Doris O. | D | 2434 RHOB | 202-225-7163 | Energy and Commerce |
7 | Bera, Ami | D | 1408 LHOB | 202-225-5716 | Foreign Affairs Science, Space, and Technology |
8 | Cook, Paul | R | 1222 LHOB | 202-225-5861 | Armed Services Foreign Affairs Veterans’ Affairs |
9 | McNerney, Jerry | D | 1210 LHOB | 202-225-1947 | Energy and Commerce |
10 | Denham, Jeff | R | 1730 LHOB | 202-225-4540 | Agriculture Transportation Veterans’ Affairs |
11 | Miller, George | D | 2205 RHOB | 202-225-2095 | Education and the Workforce |
12 | Pelosi, Nancy | D | 235 CHOB | 202-225-4965 | |
13 | Lee, Barbara | D | 2267 RHOB | 202-225-2661 | Appropriations the Budget |
14 | Speier, Jackie | D | 211 CHOB | 202-225-3531 | Armed Services Oversight and Government |
15 | Swalwell, Eric | D | 501 CHOB | 202-225-5065 | Homeland Security Science, Space, and Technology |
16 | Costa, Jim | D | 1314 LHOB | 202-225-3341 | Agriculture Natural Resources |
17 | Honda, Mike | D | 1713 LHOB | 202-225-2631 | Appropriations |
18 | Eshoo, Anna G. | D | 241 CHOB | 202-225-8104 | Energy and Commerce |
19 | Lofgren, Zoe | D | 1401 LHOB | 202-225-3072 | House Administration Joint Library Science, Space, and Technology the Judiciary |
20 | Farr, Sam | D | 1126 LHOB | 202-225-2861 | Appropriations |
21 | Valadao, David | R | 1004 LHOB | 202-225-4695 | Appropriations |
22 | Nunes, Devin | R | 1013 LHOB | 202-225-2523 | Intelligence (Permanent) Ways and Means |
23 | McCarthy, Kevin | R | 2421 RHOB | 202-225-2915 | Financial Services |
24 | Capps, Lois | D | 2231 RHOB | 202-225-3601 | Energy and Commerce |
25 | McKeon, Buck | R | 2310 RHOB | 202-225-1956 | Armed Services Education and the Workforce |
26 | Brownley, Julia | D | 1019 LHOB | 202-225-5811 | Science, Space, and Technology Veterans’ Affairs |
27 | Chu, Judy | D | 1520 LHOB | 202-225-5464 | Small Business the Judiciary |
28 | Schiff, Adam | D | 2411 RHOB | 202-225-4176 | Appropriations Intelligence (Permanent) |
29 | Cárdenas, Tony | D | 1508 LHOB | 202-225-6131 | Natural Resources Oversight and Government the Budget |
30 | Sherman, Brad | D | 2242 RHOB | 202-225-5911 | Financial Services Foreign Affairs |
31 | Miller, Gary | R | 2467 RHOB | 202-225-3201 | Financial Services Transportation |
32 | Napolitano, Grace | D | 1610 LHOB | 202-225-5256 | Natural Resources Transportation |
33 | Waxman, Henry | D | 2204 RHOB | 202-225-3976 | Energy and Commerce |
34 | Becerra, Xavier | D | 1226 LHOB | 202-225-6235 | Ways and Means |
35 | Negrete McLeod, Gloria | D | 1641 LHOB | 202-225-6161 | Agriculture Veterans’ Affairs |
36 | Ruiz, Raul | D | 1319 LHOB | 202-225-5330 | Natural Resources Veterans’ Affairs |
37 | Bass, Karen | D | 408 CHOB | 202-225-7084 | Foreign Affairs the Judiciary |
38 | Sanchez, Linda | D | 2423 RHOB | 202-225-6676 | Ethics Ways and Means |
39 | Royce, Ed | R | 2185 RHOB | 202-225-4111 | Financial Services Foreign Affairs |
40 | Roybal-Allard, Lucille | D | 2330 RHOB | 202-225-1766 | Appropriations |
41 | Takano, Mark | D | 1507 LHOB | 202-225-2305 | Education and the Workforce Veterans’ Affairs |
42 | Calvert, Ken | R | 2269 RHOB | 202-225-1986 | Appropriations the Budget |
43 | Waters, Maxine | D | 2221 RHOB | 202-225-2201 | Financial Services |
44 | Hahn, Janice | D | 404 CHOB | 202-225-8220 | Small Business Transportation |
45 | Campbell, John | R | 2331 RHOB | 202-225-5611 | Financial Services the Budget |
46 | Sanchez, Loretta | D | 1114 LHOB | 202-225-2965 | Armed Services Homeland Security |
47 | Lowenthal, Alan | D | 515 CHOB | 202-225-7924 | Foreign Affairs Natural Resources |
48 | Rohrabacher, Dana | R | 2300 RHOB | 202-225-2415 | Foreign Affairs Science, Space, and Technology |
49 | Issa, Darrell | R | 2347 RHOB | 202-225-3906 | Oversight and Government the Judiciary |
50 | Hunter, Duncan D. | R | 223 CHOB | 202-225-5672 | Armed Services Education and the Workforce Transportation |
51 | Vargas, Juan | D | 1605 LHOB | 202-225-8045 | Agriculture Foreign Affairs House Administration |
52 | Peters, Scott | D | 2410 RHOB | 202-225-0508 | Armed Services Science, Space, and Technology |
53 | Davis, Susan | D | 1526 LHOB | 202-225-2040 | Armed Services Education and the Workforce |
Colorado
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | DeGette, Diana | D | 2368 RHOB | 202-225-4431 | Energy and Commerce |
2 | Polis, Jared | D | 1433 LHOB | 202-225-2161 | Education and the Workforce Rules |
3 | Tipton, Scott | R | 218 CHOB | 202-225-4761 | Agriculture Natural Resources Small Business |
4 | Gardner, Cory | R | 213 CHOB | 202-225-4676 | Energy and Commerce |
5 | Lamborn, Doug | R | 2402 RHOB | 202-225-4422 | Armed Services Natural Resources Veterans’ Affairs |
6 | Coffman, Mike | R | 2443 RHOB | 202-225-7882 | Armed Services Small Business Veterans’ Affairs |
7 | Perlmutter, Ed | D | 1410 LHOB | 202-225-2645 | Financial Services |
Connecticut
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Larson, John B. | D | 1501 LHOB | 202-225-2265 | Ways and Means |
2 | Courtney, Joe | D | 2348 RHOB | 202-225-2076 | Agriculture Armed Services Education and the Workforce |
3 | DeLauro, Rosa L. | D | 2413 RHOB | 202-225-3661 | Appropriations |
4 | Himes, Jim | D | 119 CHOB | 202-225-5541 | Financial Services Intelligence (Permanent) |
5 | Esty, Elizabeth | D | 509 CHOB | 202-225-4476 | Science, Space, and Technology Transportation |
Delaware
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Carney, John | D | 1406 LHOB | 202-225-4165 | Financial Services |
District of Columbia
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Norton, Eleanor Holmes | D | 2136 RHOB | 202-225-8050 | Oversight and Government Transportation |
Florida
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Miller, Jeff | R | 336 CHOB | 202-225-4136 | Armed Services Intelligence (Permanent) Veterans’ Affairs |
2 | Southerland, Steve | R | 1229 LHOB | 202-225-5235 | Natural Resources Transportation |
3 | Yoho, Ted | R | 511 CHOB | 202-225-5744 | Agriculture Foreign Affairs |
4 | Crenshaw, Ander | R | 440 CHOB | 202-225-2501 | Appropriations |
5 | Brown, Corrine | D | 2111 RHOB | 202-225-0123 | Transportation Veterans’ Affairs |
6 | DeSantis, Ron | R | 427 CHOB | 202-225-2706 | Foreign Affairs Oversight and Government the Judiciary |
7 | Mica, John | R | 2187 RHOB | 202-225-4035 | Oversight and Government Transportation |
8 | Posey, Bill | R | 120 CHOB | 202-225-3671 | Financial Services Science, Space, and Technology |
9 | Grayson, Alan | D | 430 CHOB | 202-225-9889 | Foreign Affairs Science, Space, and Technology |
10 | Webster, Daniel | R | 1039 LHOB | 202-225-2176 | Rules Transportation |
11 | Nugent, Richard | R | 1727 LHOB | 202-225-1002 | Armed Services House Administration Rules |
12 | Bilirakis, Gus M. | R | 2313 RHOB | 202-225-5755 | Energy and Commerce Veterans’ Affairs |
13 | Jolly, David | R | 2407 RHOB | 202-225-5961 | Transportation Veterans’ Affairs |
14 | Castor, Kathy | D | 205 CHOB | 202-225-3376 | Energy and Commerce the Budget |
15 | Ross, Dennis | R | 229 CHOB | 202-225-1252 | Financial Services |
16 | Buchanan, Vern | R | 2104 RHOB | 202-225-5015 | Ways and Means |
17 | Rooney, Tom | R | 221 CHOB | 202-225-5792 | Appropriations Intelligence (Permanent) |
18 | Murphy, Patrick | D | 1517 LHOB | 202-225-3026 | Financial Services Small Business |
19 | Clawson,Curt | R | 1123 LHOB | 202-225-2536 | |
20 | Hastings, Alcee L. | D | 2353 RHOB | 202-225-1313 | Rules |
21 | Deutch, Ted | D | 1024 LHOB | 202-225-3001 | Ethics Foreign Affairs the Judiciary |
22 | Frankel, Lois | D | 1037 LHOB | 202-225-9890 | Foreign Affairs Transportation |
23 | Wasserman Schultz, Debbie | D | 118 CHOB | 202-225-7931 | Appropriations |
24 | Wilson, Frederica | D | 208 CHOB | 202-225-4506 | Education and the Workforce Science, Space, and Technology |
25 | Diaz-Balart, Mario | R | 436 CHOB | 202-225-4211 | Appropriations |
26 | Garcia, Joe | D | 1440 LHOB | 202-225-2778 | Natural Resources the Judiciary |
27 | Ros-Lehtinen, Ileana | R | 2206 RHOB | 202-225-3931 | Foreign Affairs Rules |
Georgia
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Kingston, Jack | R | 2372 RHOB | 202-225-5831 | Appropriations |
2 | Bishop Jr., Sanford D. | D | 2429 RHOB | 202-225-3631 | Appropriations |
3 | Westmoreland, Lynn A. | R | 2433 RHOB | 202-225-5901 | Financial Services Intelligence (Permanent) |
4 | Johnson, Henry C. “Hank” Jr. | D | 2240 RHOB | 202-225-1605 | Armed Services the Judiciary |
5 | Lewis, John | D | 343 CHOB | 202-225-3801 | Ways and Means |
6 | Price, Tom | R | 100 CHOB | 202-225-4501 | Education and the Workforce the Budget Ways and Means |
7 | Woodall, Robert | R | 1725 LHOB | 202-225-4272 | Oversight and Government Rules the Budget |
8 | Scott, Austin | R | 516 CHOB | 202-225-6531 | Agriculture Armed Services |
9 | Collins, Doug | R | 513 CHOB | 202-225-9893 | Foreign Affairs Oversight and Government the Judiciary |
10 | Broun, Paul C. | R | 2437 RHOB | 202-225-4101 | Homeland Security Natural Resources Science, Space, and Technology |
11 | Gingrey, Phil | R | 442 CHOB | 202-225-2931 | Energy and Commerce House Administration |
12 | Barrow, John | D | 2202 RHOB | 202-225-2823 | Energy and Commerce |
13 | Scott, David | D | 225 CHOB | 202-225-2939 | Agriculture Financial Services |
14 | Graves, Tom | R | 432 CHOB | 202-225-5211 | Appropriations |
Guam
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Bordallo, Madeleine | D | 2441 RHOB | 202-225-1188 | Armed Services Natural Resources |
Hawaii
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Hanabusa, Colleen | D | 238 CHOB | 202-225-2726 | Armed Services Natural Resources |
2 | Gabbard, Tulsi | D | 502 CHOB | 202-225-4906 | Armed Services Foreign Affairs |
Idaho
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Labrador, Raul R. | R | 1523 LHOB | 202-225-6611 | Natural Resources the Judiciary |
2 | Simpson, Mike | R | 2312 RHOB | 202-225-5531 | Appropriations |
Illinois
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Rush, Bobby L. | D | 2268 RHOB | 202-225-4372 | Energy and Commerce |
2 | Kelly, Robin | D | 2419 RHOB | 202-225-0773 | Oversight and Government Science, Space, and Technology |
3 | Lipinski, Daniel | D | 1717 LHOB | 202-225-5701 | Science, Space, and Technology Transportation |
4 | Gutierrez, Luis | D | 2408 RHOB | 202-225-8203 | Intelligence (Permanent) the Judiciary |
5 | Quigley, Mike | D | 1124 LHOB | 202-225-4061 | Appropriations |
6 | Roskam, Peter J. | R | 227 CHOB | 202-225-4561 | Ways and Means |
7 | Davis, Danny K. | D | 2159 RHOB | 202-225-5006 | Oversight and Government Ways and Means |
8 | Duckworth, Tammy | D | 104 CHOB | 202-225-3711 | Armed Services Oversight and Government |
9 | Schakowsky, Jan | D | 2367 RHOB | 202-225-2111 | Energy and Commerce Intelligence (Permanent) |
10 | Schneider, Brad | D | 317 CHOB | 202-225-4835 | Foreign Affairs Small Business |
11 | Foster, Bill | D | 1224 LHOB | 202-225-3515 | Financial Services |
12 | Enyart, William | D | 1722 LHOB | 202-225-5661 | Agriculture Armed Services |
13 | Davis, Rodney | R | 1740 LHOB | 202-225-2371 | Agriculture Transportation |
14 | Hultgren, Randy | R | 332 CHOB | 202-225-2976 | Financial Services Science, Space, and Technology |
15 | Shimkus, John | R | 2452 RHOB | 202-225-5271 | Energy and Commerce |
16 | Kinzinger, Adam | R | 1221 LHOB | 202-225-3635 | Energy and Commerce Foreign Affairs |
17 | Bustos, Cheri | D | 1009 LHOB | 202-225-5905 | Agriculture Transportation |
18 | Schock, Aaron | R | 328 CHOB | 202-225-6201 | House Administration Ways and Means |
Indiana
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Visclosky, Peter | D | 2256 RHOB | 202-225-2461 | Appropriations |
2 | Walorski, Jackie | R | 419 CHOB | 202-225-3915 | Armed Services the Budget Veterans’ Affairs |
3 | Stutzman, Marlin | R | 1728 LHOB | 202-225-4436 | Financial Services |
4 | Rokita, Todd | R | 236 CHOB | 202-225-5037 | Education and the Workforce House Administration the Budget |
5 | Brooks, Susan W. | R | 1505 LHOB | 202-225-2276 | Education and the Workforce Ethics Homeland Security |
6 | Messer, Luke | R | 508 CHOB | 202-225-3021 | Education and the Workforce Financial Services |
7 | Carson, André | D | 2453 RHOB | 202-225-4011 | Armed Services Transportation |
8 | Bucshon, Larry | R | 1005 LHOB | 202-225-4636 | Education and the Workforce Science, Space, and Technology Transportation |
9 | Young, Todd | R | 1007 LHOB | 202-225-5315 | Ways and Means |
Iowa
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Braley, Bruce L. | D | 2263 RHOB | 202-225-2911 | Energy and Commerce |
2 | Loebsack, David | D | 1527 LHOB | 202-225-6576 | Armed Services Education and the Workforce |
3 | Latham, Tom | R | 2217 RHOB | 202-225-5476 | Appropriations |
4 | King, Steve | R | 2210 RHOB | 202-225-4426 | Agriculture Small Business the Judiciary |
Kansas
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Huelskamp, Tim | R | 129 CHOB | 202-225-2715 | Small Business Veterans’ Affairs |
2 | Jenkins, Lynn | R | 1027 LHOB | 202-225-6601 | Ways and Means |
3 | Yoder, Kevin | R | 215 CHOB | 202-225-2865 | Appropriations |
4 | Pompeo, Mike | R | 107 CHOB | 202-225-6216 | Energy and Commerce Intelligence (Permanent) |
Kentucky
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Whitfield, Ed | R | 2184 RHOB | 202-225-3115 | Energy and Commerce |
2 | Guthrie, S. Brett | R | 308 CHOB | 202-225-3501 | Education and the Workforce Energy and Commerce |
3 | Yarmuth, John A. | D | 403 CHOB | 202-225-5401 | Energy and Commerce the Budget |
4 | Massie, Thomas | R | 314 CHOB | 202-225-3465 | Oversight and Government Science, Space, and Technology Transportation |
5 | Rogers, Harold | R | 2406 RHOB | 202-225-4601 | Appropriations |
6 | Barr, Andy | R | 1432 LHOB | 202-225-4706 | Financial Services |
Louisiana
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Scalise, Steve | R | 2338 RHOB | 202-225-3015 | Energy and Commerce |
2 | Richmond, Cedric | D | 240 CHOB | 202-225-6636 | Homeland Security the Judiciary |
3 | Boustany Jr., Charles W. | R | 1431 LHOB | 202-225-2031 | Ways and Means |
4 | Fleming, John | R | 416 CHOB | 202-225-2777 | Armed Services Natural Resources |
5 | McAllister, Vance | R | 316 CHOB | 202-225-8490 | Agriculture Natural Resources |
6 | Cassidy, William | R | 1131 LHOB | 202-225-3901 | Energy and Commerce |
Maine
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Pingree, Chellie | D | 1318 LHOB | 202-225-6116 | Appropriations |
2 | Michaud, Michael | D | 1724 LHOB | 202-225-6306 | Transportation Veterans’ Affairs |
Maryland
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Harris, Andy | R | 1533 LHOB | 202-225-5311 | Appropriations |
2 | Ruppersberger, Dutch | D | 2416 RHOB | 202-225-3061 | Intelligence (Permanent) |
3 | Sarbanes, John P. | D | 2444 RHOB | 202-225-4016 | Energy and Commerce |
4 | Edwards, Donna F. | D | 2445 RHOB | 202-225-8699 | Science, Space, and Technology Transportation |
5 | Hoyer, Steny H. | D | 1705 LHOB | 202-225-4131 | |
6 | Delaney, John | D | 1632 LHOB | 202-225-2721 | Financial Services |
7 | Cummings, Elijah | D | 2235 RHOB | 202-225-4741 | Oversight and Government Transportation |
8 | Van Hollen, Chris | D | 1707 LHOB | 202-225-5341 | the Budget |
Massachusetts
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Neal, Richard E. | D | 2208 RHOB | 202-225-5601 | Ways and Means |
2 | McGovern, James | D | 438 CHOB | 202-225-6101 | Agriculture Rules |
3 | Tsongas, Niki | D | 1607 LHOB | 202-225-3411 | Armed Services Natural Resources |
4 | Kennedy III, Joseph P. | D | 1218 LHOB | 202-225-5931 | Foreign Affairs Science, Space, and Technology |
5 | Clark, Katherine | D | 2108 RHOB | 202-225-2836 | Natural Resources Science, Space, and Technology |
6 | Tierney, John | D | 2238 RHOB | 202-225-8020 | Education and the Workforce Oversight and Government |
7 | Capuano, Michael E. | D | 1414 LHOB | 202-225-5111 | Ethics Financial Services Transportation |
8 | Lynch, Stephen F. | D | 2133 RHOB | 202-225-8273 | Financial Services Oversight and Government |
9 | Keating, William | D | 315 CHOB | 202-225-3111 | Foreign Affairs Homeland Security |
Michigan
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Benishek, Dan | R | 514 CHOB | 202-225-4735 | Agriculture Natural Resources Veterans’ Affairs |
2 | Huizenga, Bill | R | 1217 LHOB | 202-225-4401 | Financial Services |
3 | Amash, Justin | R | 114 CHOB | 202-225-3831 | Oversight and Government |
4 | Camp, Dave | R | 341 CHOB | 202-225-3561 | Joint Taxation Ways and Means |
5 | Kildee, Daniel | D | 327 CHOB | 202-225-3611 | Financial Services the Budget |
6 | Upton, Fred | R | 2183 RHOB | 202-225-3761 | Energy and Commerce |
7 | Walberg, Tim | R | 2436 RHOB | 202-225-6276 | Education and the Workforce Oversight and Government |
8 | Rogers (MI), Mike | R | 2112 RHOB | 202-225-4872 | Energy and Commerce Intelligence (Permanent) |
9 | Levin, Sander | D | 1236 LHOB | 202-225-4961 | Joint Taxation Ways and Means |
10 | Miller, Candice | R | 320 CHOB | 202-225-2106 | Homeland Security House Administration Joint Library Transportation |
11 | Bentivolio, Kerry | R | 226 CHOB | 202-225-8171 | Oversight and Government Small Business |
12 | Dingell, John | D | 2328 RHOB | 202-225-4071 | Energy and Commerce |
13 | Conyers Jr., John | D | 2426 RHOB | 202-225-5126 | the Judiciary |
14 | Peters, Gary | D | 1609 LHOB | 202-225-5802 | Financial Services |
Minnesota
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Walz, Timothy J. | D | 1034 LHOB | 202-225-2472 | Agriculture Transportation Veterans’ Affairs |
2 | Kline, John | R | 2439 RHOB | 202-225-2271 | Armed Services Education and the Workforce |
3 | Paulsen, Erik | R | 127 CHOB | 202-225-2871 | Ways and Means |
4 | McCollum, Betty | D | 1714 LHOB | 202-225-6631 | Appropriations |
5 | Ellison, Keith | D | 2244 RHOB | 202-225-4755 | Financial Services |
6 | Bachmann, Michele | R | 2417 RHOB | 202-225-2331 | Financial Services Intelligence (Permanent) |
7 | Peterson, Collin C. | D | 2109 RHOB | 202-225-2165 | Agriculture |
8 | Nolan, Rick | D | 2447 RHOB | 202-225-6211 | Agriculture Transportation |
Mississippi
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Nunnelee, Alan | R | 1427 LHOB | 202-225-4306 | Appropriations the Budget |
2 | Thompson, Bennie G. | D | 2466 RHOB | 202-225-5876 | Homeland Security |
3 | Harper, Gregg | R | 307 CHOB | 202-225-5031 | Energy and Commerce House Administration Joint Library |
4 | Palazzo, Steven | R | 331 CHOB | 202-225-5772 | Armed Services Homeland Security Science, Space, and Technology |
Missouri
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Clay Jr., William “Lacy” | D | 2418 RHOB | 202-225-2406 | Financial Services Oversight and Government |
2 | Wagner, Ann | R | 435 CHOB | 202-225-1621 | Financial Services |
3 | Luetkemeyer, Blaine | R | 2440 RHOB | 202-225-2956 | Financial Services Small Business |
4 | Hartzler, Vicky | R | 1023 LHOB | 202-225-2876 | Agriculture Armed Services the Budget |
5 | Cleaver, Emanuel | D | 2335 RHOB | 202-225-4535 | Financial Services |
6 | Graves, Sam | R | 1415 LHOB | 202-225-7041 | Small Business Transportation |
7 | Long, Billy | R | 1541 LHOB | 202-225-6536 | Energy and Commerce |
8 | Smith, Jason | R | 2230 RHOB | 202-225-4404 | Natural Resources the Judiciary |
Montana
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Daines, Steve | R | 206 CHOB | 202-225-3211 | Homeland Security Natural Resources Transportation |
Nebraska
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Fortenberry, Jeff | R | 1514 LHOB | 202-225-4806 | Appropriations |
2 | Terry, Lee | R | 2266 RHOB | 202-225-4155 | Energy and Commerce |
3 | Smith, Adrian | R | 2241 RHOB | 202-225-6435 | Ways and Means |
Nevada
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Titus, Dina | D | 401 CHOB | 202-225-5965 | Transportation Veterans’ Affairs |
2 | Amodei, Mark | R | 222 CHOB | 202-225-6155 | Appropriations |
3 | Heck, Joe | R | 132 CHOB | 202-225-3252 | Armed Services Education and the Workforce Intelligence (Permanent) |
4 | Horsford, Steven | D | 1330 LHOB | 202-225-9894 | Financial Services Oversight and Government |
New Hampshire
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Shea-Porter, Carol | D | 1530 LHOB | 202-225-5456 | Armed Services Natural Resources |
2 | Kuster, Ann | D | 137 CHOB | 202-225-5206 | Agriculture Small Business Veterans’ Affairs |
New Jersey
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Andrews, Robert E. — Vacancy | D | 2265 RHOB | 202-225-6501 | |
2 | LoBiondo, Frank | R | 2427 RHOB | 202-225-6572 | Armed Services Intelligence (Permanent) Transportation |
3 | Runyan, Jon | R | 1239 LHOB | 202-225-4765 | Armed Services Natural Resources Veterans’ Affairs |
4 | Smith, Chris | R | 2373 RHOB | 202-225-3765 | Foreign Affairs |
5 | Garrett, Scott | R | 2232 RHOB | 202-225-4465 | Financial Services the Budget |
6 | Pallone Jr., Frank | D | 237 CHOB | 202-225-4671 | Energy and Commerce Natural Resources |
7 | Lance, Leonard | R | 133 CHOB | 202-225-5361 | Energy and Commerce |
8 | Sires, Albio | D | 2342 RHOB | 202-225-7919 | Foreign Affairs Transportation |
9 | Pascrell Jr., Bill | D | 2370 RHOB | 202-225-5751 | the Budget Ways and Means |
10 | Payne Jr., Donald | D | 103 CHOB | 202-225-3436 | Homeland Security Small Business |
11 | Frelinghuysen, Rodney | R | 2306 RHOB | 202-225-5034 | Appropriations |
12 | Holt, Rush | D | 1214 LHOB | 202-225-5801 | Education and the Workforce Natural Resources |
New Mexico
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Lujan Grisham, Michelle | D | 214 CHOB | 202-225-6316 | Agriculture Oversight and Government the Budget |
2 | Pearce, Steve | R | 2432 RHOB | 202-225-2365 | Financial Services |
3 | Lujan, Ben R. | D | 2446 RHOB | 202-225-6190 | Energy and Commerce |
New York
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Bishop, Timothy | D | 306 CHOB | 202-225-3826 | Education and the Workforce Transportation |
2 | King, Pete | R | 339 CHOB | 202-225-7896 | Financial Services Homeland Security Intelligence (Permanent) |
3 | Israel, Steve | D | 2457 RHOB | 202-225-3335 | |
4 | McCarthy, Carolyn | D | 2346 RHOB | 202-225-5516 | Education and the Workforce Financial Services |
5 | Meeks, Gregory W. | D | 2234 RHOB | 202-225-3461 | Financial Services Foreign Affairs |
6 | Meng, Grace | D | 1317 LHOB | 202-225-2601 | Foreign Affairs Small Business |
7 | Velázquez, Nydia M. | D | 2302 RHOB | 202-225-2361 | Financial Services Small Business |
8 | Jeffries, Hakeem | D | 1339 LHOB | 202-225-5936 | the Budget the Judiciary |
9 | Clarke, Yvette D. | D | 2351 RHOB | 202-225-6231 | Ethics Homeland Security Small Business |
10 | Nadler, Jerrold | D | 2110 RHOB | 202-225-5635 | the Judiciary Transportation |
11 | Grimm, Michael | R | 512 CHOB | 202-225-3371 | |
12 | Maloney, Carolyn | D | 2308 RHOB | 202-225-7944 | Financial Services Oversight and Government |
13 | Rangel, Charles B. | D | 2354 RHOB | 202-225-4365 | Joint Taxation Ways and Means |
14 | Crowley, Joseph | D | 1436 LHOB | 202-225-3965 | Ways and Means |
15 | Serrano, José E. | D | 2227 RHOB | 202-225-4361 | Appropriations |
16 | Engel, Eliot | D | 2161 RHOB | 202-225-2464 | Energy and Commerce Foreign Affairs |
17 | Lowey, Nita | D | 2365 RHOB | 202-225-6506 | Appropriations |
18 | Maloney, Sean Patrick | D | 1529 LHOB | 202-225-5441 | Agriculture Transportation |
19 | Gibson, Chris | R | 1708 LHOB | 202-225-5614 | Agriculture Armed Services |
20 | Tonko, Paul D. | D | 2463 RHOB | 202-225-5076 | Energy and Commerce |
21 | Owens, Bill | D | 405 CHOB | 202-225-4611 | Appropriations |
22 | Hanna, Richard | R | 319 CHOB | 202-225-3665 | Small Business Transportation |
23 | Reed, Tom | R | 1504 LHOB | 202-225-3161 | Ways and Means |
24 | Maffei, Daniel | D | 422 CHOB | 202-225-3701 | Armed Services Science, Space, and Technology |
25 | Slaughter, Louise | D | 2469 RHOB | 202-225-3615 | Rules |
26 | Higgins, Brian | D | 2459 RHOB | 202-225-3306 | Foreign Affairs Homeland Security |
27 | Collins, Chris | R | 1117 LHOB | 202-225-5265 | Agriculture Science, Space, and Technology Small Business |
North Carolina
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Butterfield, G.K. | D | 2305 RHOB | 202-225-3101 | Energy and Commerce |
2 | Ellmers, Renee | R | 426 CHOB | 202-225-4531 | Energy and Commerce |
3 | Jones, Walter B. | R | 2333 RHOB | 202-225-3415 | Armed Services |
4 | Price, David | D | 2162 RHOB | 202-225-1784 | Appropriations |
5 | Foxx, Virginia | R | 2350 RHOB | 202-225-2071 | Education and the Workforce Rules |
6 | Coble, Howard | R | 2188 RHOB | 202-225-3065 | the Judiciary Transportation |
7 | McIntyre, Mike | D | 2428 RHOB | 202-225-2731 | Agriculture Armed Services |
8 | Hudson, Richard | R | 429 CHOB | 202-225-3715 | Agriculture Education and the Workforce Homeland Security |
9 | Pittenger, Robert | R | 224 CHOB | 202-225-1976 | Financial Services |
10 | McHenry, Patrick T. | R | 2334 RHOB | 202-225-2576 | Financial Services Oversight and Government |
11 | Meadows, Mark | R | 1516 LHOB | 202-225-6401 | Foreign Affairs Oversight and Government Transportation |
12 | Watt, Mel — Vacancy | D | 2304 RHOB | 202-225-1510 | |
13 | Holding, George | R | 507 CHOB | 202-225-3032 | Foreign Affairs the Judiciary |
North Dakota
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Cramer, Kevin | R | 1032 LHOB | 202-225-2611 | Natural Resources Science, Space, and Technology |
Northern Mariana Islands
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Sablan, Gregorio | D | 423 CHOB | 202-225-2646 | Education and the Workforce Natural Resources |
Ohio
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Chabot, Steve | R | 2371 RHOB | 202-225-2216 | Foreign Affairs Small Business the Judiciary |
2 | Wenstrup, Brad | R | 1223 LHOB | 202-225-3164 | Armed Services Veterans’ Affairs |
3 | Beatty, Joyce | D | 417 CHOB | 202-225-4324 | Financial Services |
4 | Jordan, Jim | R | 1524 LHOB | 202-225-2676 | Oversight and Government the Judiciary |
5 | Latta, Robert E. | R | 2448 RHOB | 202-225-6405 | Energy and Commerce |
6 | Johnson, Bill | R | 1710 LHOB | 202-225-5705 | Energy and Commerce Science, Space, and Technology |
7 | Gibbs, Bob | R | 329 CHOB | 202-225-6265 | Agriculture Transportation |
8 | Boehner, John A. | R | 1011 LHOB | 202-225-6205 | |
9 | Kaptur, Marcy | D | 2186 RHOB | 202-225-4146 | Appropriations |
10 | Turner, Michael | R | 2239 RHOB | 202-225-6465 | Armed Services Oversight and Government |
11 | Fudge, Marcia L. | D | 2344 RHOB | 202-225-7032 | Agriculture Education and the Workforce |
12 | Tiberi, Pat | R | 106 CHOB | 202-225-5355 | Ways and Means |
13 | Ryan, Tim | D | 1421 LHOB | 202-225-5261 | Appropriations the Budget |
14 | Joyce, David | R | 1535 LHOB | 202-225-5731 | Appropriations |
15 | Stivers, Steve | R | 1022 LHOB | 202-225-2015 | Financial Services |
16 | Renacci, Jim | R | 130 CHOB | 202-225-3876 | Ways and Means |
Oklahoma
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Bridenstine, Jim | R | 216 CHOB | 202-225-2211 | Armed Services Science, Space, and Technology |
2 | Mullin, Markwayne | R | 1113 LHOB | 202-225-2701 | Natural Resources Transportation |
3 | Lucas, Frank | R | 2311 RHOB | 202-225-5565 | Agriculture Financial Services Science, Space, and Technology |
4 | Cole, Tom | R | 2458 RHOB | 202-225-6165 | Appropriations Joint Library Rules the Budget |
5 | Lankford, James | R | 228 CHOB | 202-225-2132 | Oversight and Government the Budget |
Oregon
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Bonamici, Suzanne | D | 439 CHOB | 202-225-0855 | Education and the Workforce Science, Space, and Technology |
2 | Walden, Greg | R | 2182 RHOB | 202-225-6730 | Energy and Commerce |
3 | Blumenauer, Earl | D | 1111 LHOB | 202-225-4811 | the Budget Ways and Means |
4 | DeFazio, Peter | D | 2134 RHOB | 202-225-6416 | Natural Resources Transportation |
5 | Schrader, Kurt | D | 108 CHOB | 202-225-5711 | Agriculture Small Business the Budget |
Pennsylvania
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Brady, Robert | D | 102 CHOB | 202-225-4731 | Armed Services House Administration Joint Library |
2 | Fattah, Chaka | D | 2301 RHOB | 202-225-4001 | Appropriations |
3 | Kelly, Mike | R | 1519 LHOB | 202-225-5406 | Education and the Workforce Ways and Means |
4 | Perry, Scott | R | 126 CHOB | 202-225-5836 | Foreign Affairs Homeland Security Transportation |
5 | Thompson, Glenn W. | R | 124 CHOB | 202-225-5121 | Agriculture Education and the Workforce Natural Resources |
6 | Gerlach, Jim | R | 2442 RHOB | 202-225-4315 | Ways and Means |
7 | Meehan, Pat | R | 204 CHOB | 202-225-2011 | Ethics Homeland Security Oversight and Government Transportation |
8 | Fitzpatrick, Michael G. | R | 2400 RHOB | 202-225-4276 | Financial Services |
9 | Shuster, Bill | R | 2209 RHOB | 202-225-2431 | Armed Services Transportation |
10 | Marino, Tom | R | 410 CHOB | 202-225-3731 | Foreign Affairs Homeland Security the Judiciary |
11 | Barletta, Lou | R | 115 CHOB | 202-225-6511 | Education and the Workforce Homeland Security Transportation |
12 | Rothfus, Keith | R | 503 CHOB | 202-225-2065 | Financial Services |
13 | Schwartz, Allyson Y. | D | 1227 LHOB | 202-225-6111 | Ways and Means |
14 | Doyle, Mike | D | 239 CHOB | 202-225-2135 | Energy and Commerce |
15 | Dent, Charles W. | R | 2455 RHOB | 202-225-6411 | Appropriations Ethics |
16 | Pitts, Joseph R. | R | 420 CHOB | 202-225-2411 | Energy and Commerce |
17 | Cartwright, Matthew | D | 1419 LHOB | 202-225-5546 | Natural Resources Oversight and Government |
18 | Murphy, Tim | R | 2332 RHOB | 202-225-2301 | Energy and Commerce |
Puerto Rico
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Pierluisi, Pedro | D | 1213 LHOB | 202-225-2615 | Ethics Natural Resources the Judiciary |
Rhode Island
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Cicilline, David | D | 128 CHOB | 202-225-4911 | Foreign Affairs the Judiciary |
2 | Langevin, Jim | D | 109 CHOB | 202-225-2735 | Armed Services Intelligence (Permanent) |
South Carolina
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Sanford, Mark | R | 322 CHOB | 202-225-3176 | Homeland Security Transportation |
2 | Wilson, Joe | R | 2229 RHOB | 202-225-2452 | Armed Services Education and the Workforce Foreign Affairs |
3 | Duncan, Jeff | R | 116 CHOB | 202-225-5301 | Foreign Affairs Homeland Security Natural Resources |
4 | Gowdy, Trey | R | 1404 LHOB | 202-225-6030 | Ethics Oversight and Government the Judiciary |
5 | Mulvaney, Mick | R | 1207 LHOB | 202-225-5501 | Financial Services Small Business |
6 | Clyburn, James E. | D | 242 CHOB | 202-225-3315 | |
7 | Rice, Tom | R | 325 CHOB | 202-225-9895 | Small Business the Budget Transportation |
South Dakota
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Noem, Kristi | R | 1323 LHOB | 202-225-2801 | Agriculture Armed Services |
Tennessee
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Roe, Phil | R | 407 CHOB | 202-225-6356 | Education and the Workforce Veterans’ Affairs |
2 | Duncan Jr., John J. | R | 2207 RHOB | 202-225-5435 | Oversight and Government Transportation |
3 | Fleischmann, Chuck | R | 230 CHOB | 202-225-3271 | Appropriations |
4 | DesJarlais, Scott | R | 413 CHOB | 202-225-6831 | Agriculture Education and the Workforce Oversight and Government |
5 | Cooper, Jim | D | 1536 LHOB | 202-225-4311 | Armed Services Oversight and Government |
6 | Black, Diane | R | 1531 LHOB | 202-225-4231 | the Budget Ways and Means |
7 | Blackburn, Marsha | R | 217 CHOB | 202-225-2811 | Energy and Commerce the Budget |
8 | Fincher, Stephen | R | 1118 LHOB | 202-225-4714 | Agriculture Financial Services |
9 | Cohen, Steve | D | 2404 RHOB | 202-225-3265 | the Judiciary Transportation |
Texas
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Gohmert, Louie | R | 2243 RHOB | 202-225-3035 | Natural Resources the Judiciary |
2 | Poe, Ted | R | 2412 RHOB | 202-225-6565 | Foreign Affairs the Judiciary |
3 | Johnson, Sam | R | 1211 LHOB | 202-225-4201 | Joint Taxation Ways and Means |
4 | Hall, Ralph M. | R | 2405 RHOB | 202-225-6673 | Energy and Commerce Science, Space, and Technology |
5 | Hensarling, Jeb | R | 2228 RHOB | 202-225-3484 | Financial Services |
6 | Barton, Joe | R | 2107 RHOB | 202-225-2002 | Energy and Commerce |
7 | Culberson, John | R | 2352 RHOB | 202-225-2571 | Appropriations |
8 | Brady, Kevin | R | 301 CHOB | 202-225-4901 | Joint Taxation Ways and Means |
9 | Green, Al | D | 2201 RHOB | 202-225-7508 | Financial Services |
10 | McCaul, Michael T. | R | 131 CHOB | 202-225-2401 | Foreign Affairs Homeland Security Science, Space, and Technology |
11 | Conaway, K. Michael | R | 2430 RHOB | 202-225-3605 | Agriculture Armed Services Ethics Intelligence (Permanent) |
12 | Granger, Kay | R | 1026 LHOB | 202-225-5071 | Appropriations |
13 | Thornberry, Mac | R | 2329 RHOB | 202-225-3706 | Armed Services Intelligence (Permanent) |
14 | Weber, Randy | R | 510 CHOB | 202-225-2831 | Foreign Affairs Science, Space, and Technology |
15 | Hinojosa, Rubén | D | 2262 RHOB | 202-225-2531 | Education and the Workforce Financial Services |
16 | O’Rourke, Beto | D | 1721 LHOB | 202-225-4831 | Homeland Security Veterans’ Affairs |
17 | Flores, Bill | R | 1030 LHOB | 202-225-6105 | Natural Resources the Budget Veterans’ Affairs |
18 | Jackson Lee, Sheila | D | 2160 RHOB | 202-225-3816 | Homeland Security the Judiciary |
19 | Neugebauer, Randy | R | 1424 LHOB | 202-225-4005 | Agriculture Financial Services Science, Space, and Technology |
20 | Castro, Joaquin | D | 212 CHOB | 202-225-3236 | Armed Services Foreign Affairs |
21 | Smith, Lamar | R | 2409 RHOB | 202-225-4236 | Homeland Security Science, Space, and Technology the Judiciary |
22 | Olson, Pete | R | 312 CHOB | 202-225-5951 | Energy and Commerce |
23 | Gallego, Pete | D | 431 CHOB | 202-225-4511 | Agriculture Armed Services |
24 | Marchant, Kenny | R | 1110 LHOB | 202-225-6605 | Education and the Workforce Ways and Means |
25 | Williams, Roger | R | 1122 LHOB | 202-225-9896 | the Budget Transportation |
26 | Burgess, Michael | R | 2336 RHOB | 202-225-7772 | Energy and Commerce Rules |
27 | Farenthold, Blake | R | 117 CHOB | 202-225-7742 | Oversight and Government the Judiciary Transportation |
28 | Cuellar, Henry | D | 2431 RHOB | 202-225-1640 | Appropriations |
29 | Green, Gene | D | 2470 RHOB | 202-225-1688 | Energy and Commerce |
30 | Johnson, Eddie Bernice | D | 2468 RHOB | 202-225-8885 | Science, Space, and Technology Transportation |
31 | Carter, John | R | 409 CHOB | 202-225-3864 | Appropriations |
32 | Sessions, Pete | R | 2233 RHOB | 202-225-2231 | Rules |
33 | Veasey, Marc | D | 414 CHOB | 202-225-9897 | Armed Services Science, Space, and Technology |
34 | Vela, Filemon | D | 437 CHOB | 202-225-9901 | Agriculture Homeland Security |
35 | Doggett, Lloyd | D | 201 CHOB | 202-225-4865 | the Budget Ways and Means |
36 | Stockman, Steve | R | 326 CHOB | 202-225-1555 | Foreign Affairs Science, Space, and Technology |
Utah
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Bishop, Rob | R | 123 CHOB | 202-225-0453 | Armed Services Natural Resources Rules |
2 | Stewart, Chris | R | 323 CHOB | 202-225-9730 | Appropriations |
3 | Chaffetz, Jason | R | 2464 RHOB | 202-225-7751 | Homeland Security Oversight and Government the Judiciary |
4 | Matheson, Jim | D | 2211 RHOB | 202-225-3011 | Energy and Commerce |
Vermont
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Welch, Peter | D | 2303 RHOB | 202-225-4115 | Energy and Commerce Oversight and Government |
Virgin Islands
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Christensen, Donna M., | D | 1510 LHOB | 202-225-1790 | Energy and Commerce |
Virginia
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Wittman, Robert J. | R | 2454 RHOB | 202-225-4261 | Armed Services Natural Resources |
2 | Rigell, Scott | R | 418 CHOB | 202-225-4215 | Armed Services the Budget |
3 | Scott, Robert C. | D | 1201 LHOB | 202-225-8351 | Education and the Workforce the Judiciary |
4 | Forbes, J. Randy | R | 2135 RHOB | 202-225-6365 | Armed Services the Judiciary |
5 | Hurt, Robert | R | 125 CHOB | 202-225-4711 | Financial Services |
6 | Goodlatte, Bob | R | 2309 RHOB | 202-225-5431 | Agriculture the Judiciary |
7 | Cantor, Eric | R | 303 CHOB | 202-225-2815 | |
8 | Moran, James | D | 2252 RHOB | 202-225-4376 | Appropriations |
9 | Griffith, Morgan | R | 1108 LHOB | 202-225-3861 | Energy and Commerce |
10 | Wolf, Frank | R | 233 CHOB | 202-225-5136 | Appropriations |
11 | Connolly, Gerald E. “Gerry” | D | 424 CHOB | 202-225-1492 | Foreign Affairs Oversight and Government |
Washington
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | DelBene, Suzan | D | 318 CHOB | 202-225-6311 | Agriculture the Judiciary |
2 | Larsen, Rick | D | 2113 RHOB | 202-225-2605 | Armed Services Transportation |
3 | Herrera Beutler, Jaime | R | 1130 LHOB | 202-225-3536 | Appropriations Small Business |
4 | Hastings, Doc | R | 1203 LHOB | 202-225-5816 | Natural Resources Oversight and Government |
5 | McMorris Rodgers, Cathy | R | 203 CHOB | 202-225-2006 | Energy and Commerce |
6 | Kilmer, Derek | D | 1429 LHOB | 202-225-5916 | Armed Services Science, Space, and Technology |
7 | McDermott, Jim | D | 1035 LHOB | 202-225-3106 | the Budget Ways and Means |
8 | Reichert, David G. | R | 1127 LHOB | 202-225-7761 | Ways and Means |
9 | Smith, Adam | D | 2264 RHOB | 202-225-8901 | Armed Services |
10 | Heck, Denny | D | 425 CHOB | 202-225-9740 | Financial Services |
West Virginia
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | McKinley, David | R | 412 CHOB | 202-225-4172 | Energy and Commerce |
2 | Capito, Shelley Moore | R | 2366 RHOB | 202-225-2711 | Financial Services Transportation |
3 | Rahall, Nick | D | 2307 RHOB | 202-225-3452 | Transportation |
Wisconsin
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | Ryan, Paul | R | 1233 LHOB | 202-225-3031 | the Budget Ways and Means |
2 | Pocan, Mark | D | 313 CHOB | 202-225-2906 | Education and the Workforce the Budget |
3 | Kind, Ron | D | 1502 LHOB | 202-225-5506 | Ways and Means |
4 | Moore, Gwen | D | 2245 RHOB | 202-225-4572 | Financial Services the Budget |
5 | Sensenbrenner, F. James | R | 2449 RHOB | 202-225-5101 | Science, Space, and Technology the Judiciary |
6 | Petri, Thomas | R | 2462 RHOB | 202-225-2476 | Education and the Workforce Transportation |
7 | Duffy, Sean P. | R | 1208 LHOB | 202-225-3365 | Financial Services Foreign Affairs the Budget |
8 | Ribble, Reid | R | 1513 LHOB | 202-225-5665 | Agriculture the Budget Transportation |
Wyoming
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
At Large | Lummis, Cynthia M. | R | 113 CHOB | 202-225-2311 | Natural Resources Oversight and Government Science, Space, and Technology |
A
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Aderholt, Robert | Alabama 4th District | R | 2369 RHOB | 202-225-4876 | Appropriations |
Amash, Justin | Michigan 3rd District | R | 114 CHOB | 202-225-3831 | Oversight and Government |
Amodei, Mark | Nevada 2nd District | R | 222 CHOB | 202-225-6155 | Appropriations |
Andrews, Robert E. — Vacancy | New Jersey 1st District | D | 2265 RHOB | 202-225-6501 |
B
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Bachmann, Michele | Minnesota 6th District | R | 2417 RHOB | 202-225-2331 | Financial Services Intelligence (Permanent) |
Bachus, Spencer | Alabama 6th District | R | 2246 RHOB | 202-225-4921 | Financial Services the Judiciary |
Barber, Ron | Arizona 2nd District | D | 1029 LHOB | 202-225-2542 | Armed Services Homeland Security Small Business |
Barletta, Lou | Pennsylvania 11th District | R | 115 CHOB | 202-225-6511 | Education and the Workforce Homeland Security Transportation |
Barr, Andy | Kentucky 6th District | R | 1432 LHOB | 202-225-4706 | Financial Services |
Barrow, John | Georgia 12th District | D | 2202 RHOB | 202-225-2823 | Energy and Commerce |
Barton, Joe | Texas 6th District | R | 2107 RHOB | 202-225-2002 | Energy and Commerce |
Bass, Karen | California 37th District | D | 408 CHOB | 202-225-7084 | Foreign Affairs the Judiciary |
Beatty, Joyce | Ohio 3rd District | D | 417 CHOB | 202-225-4324 | Financial Services |
Becerra, Xavier | California 34th District | D | 1226 LHOB | 202-225-6235 | Ways and Means |
Benishek, Dan | Michigan 1st District | R | 514 CHOB | 202-225-4735 | Agriculture Natural Resources Veterans’ Affairs |
Bentivolio, Kerry | Michigan 11th District | R | 226 CHOB | 202-225-8171 | Oversight and Government Small Business |
Bera, Ami | California 7th District | D | 1408 LHOB | 202-225-5716 | Foreign Affairs Science, Space, and Technology |
Bilirakis, Gus M. | Florida 12th District | R | 2313 RHOB | 202-225-5755 | Energy and Commerce Veterans’ Affairs |
Bishop Jr., Sanford D. | Georgia 2nd District | D | 2429 RHOB | 202-225-3631 | Appropriations |
Bishop, Rob | Utah 1st District | R | 123 CHOB | 202-225-0453 | Armed Services Natural Resources Rules |
Bishop, Timothy | New York 1st District | D | 306 CHOB | 202-225-3826 | Education and the Workforce Transportation |
Black, Diane | Tennessee 6th District | R | 1531 LHOB | 202-225-4231 | the Budget Ways and Means |
Blackburn, Marsha | Tennessee 7th District | R | 217 CHOB | 202-225-2811 | Energy and Commerce the Budget |
Blumenauer, Earl | Oregon 3rd District | D | 1111 LHOB | 202-225-4811 | the Budget Ways and Means |
Boehner, John A. | Ohio 8th District | R | 1011 LHOB | 202-225-6205 | |
Bonamici, Suzanne | Oregon 1st District | D | 439 CHOB | 202-225-0855 | Education and the Workforce Science, Space, and Technology |
Bordallo, Madeleine | Guam At-Large | D | 2441 RHOB | 202-225-1188 | Armed Services Natural Resources |
Boustany Jr., Charles W. | Louisiana 3rd District | R | 1431 LHOB | 202-225-2031 | Ways and Means |
Brady, Kevin | Texas 8th District | R | 301 CHOB | 202-225-4901 | Joint Taxation Ways and Means |
Brady, Robert | Pennsylvania 1st District | D | 102 CHOB | 202-225-4731 | Armed Services House Administration Joint Library |
Braley, Bruce L. | Iowa 1st District | D | 2263 RHOB | 202-225-2911 | Energy and Commerce |
Bridenstine, Jim | Oklahoma 1st District | R | 216 CHOB | 202-225-2211 | Armed Services Science, Space, and Technology |
Brooks, Mo | Alabama 5th District | R | 1230 LHOB | 202-225-4801 | Armed Services Foreign Affairs Science, Space, and Technology |
Brooks, Susan W. | Indiana 5th District | R | 1505 LHOB | 202-225-2276 | Education and the Workforce Ethics Homeland Security |
Broun, Paul C. | Georgia 10th District | R | 2437 RHOB | 202-225-4101 | Homeland Security Natural Resources Science, Space, and Technology |
Brown, Corrine | Florida 5th District | D | 2111 RHOB | 202-225-0123 | Transportation Veterans’ Affairs |
Brownley, Julia | California 26th District | D | 1019 LHOB | 202-225-5811 | Science, Space, and Technology Veterans’ Affairs |
Buchanan, Vern | Florida 16th District | R | 2104 RHOB | 202-225-5015 | Ways and Means |
Bucshon, Larry | Indiana 8th District | R | 1005 LHOB | 202-225-4636 | Education and the Workforce Science, Space, and Technology Transportation |
Burgess, Michael | Texas 26th District | R | 2336 RHOB | 202-225-7772 | Energy and Commerce Rules |
Bustos, Cheri | Illinois 17th District | D | 1009 LHOB | 202-225-5905 | Agriculture Transportation |
Butterfield, G.K. | North Carolina 1st District | D | 2305 RHOB | 202-225-3101 | Energy and Commerce |
Byrne,Bradley | Alabama 1st District | R | 2236 RHOB | 202-225-4931 | Armed Services Education and the Workforce Natural Resources |
C
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Calvert, Ken | California 42nd District | R | 2269 RHOB | 202-225-1986 | Appropriations the Budget |
Camp, Dave | Michigan 4th District | R | 341 CHOB | 202-225-3561 | Joint Taxation Ways and Means |
Campbell, John | California 45th District | R | 2331 RHOB | 202-225-5611 | Financial Services the Budget |
Cantor, Eric | Virginia 7th District | R | 303 CHOB | 202-225-2815 | |
Capito, Shelley Moore | West Virginia 2nd District | R | 2366 RHOB | 202-225-2711 | Financial Services Transportation |
Capps, Lois | California 24th District | D | 2231 RHOB | 202-225-3601 | Energy and Commerce |
Capuano, Michael E. | Massachusetts 7th District | D | 1414 LHOB | 202-225-5111 | Ethics Financial Services Transportation |
Carney, John | Delaware At-Large | D | 1406 LHOB | 202-225-4165 | Financial Services |
Carson, André | Indiana 7th District | D | 2453 RHOB | 202-225-4011 | Armed Services Transportation |
Carter, John | Texas 31st District | R | 409 CHOB | 202-225-3864 | Appropriations |
Cartwright, Matthew | Pennsylvania 17th District | D | 1419 LHOB | 202-225-5546 | Natural Resources Oversight and Government |
Cassidy, William | Louisiana 6th District | R | 1131 LHOB | 202-225-3901 | Energy and Commerce |
Castor, Kathy | Florida 14th District | D | 205 CHOB | 202-225-3376 | Energy and Commerce the Budget |
Castro, Joaquin | Texas 20th District | D | 212 CHOB | 202-225-3236 | Armed Services Foreign Affairs |
Chabot, Steve | Ohio 1st District | R | 2371 RHOB | 202-225-2216 | Foreign Affairs Small Business the Judiciary |
Chaffetz, Jason | Utah 3rd District | R | 2464 RHOB | 202-225-7751 | Homeland Security Oversight and Government the Judiciary |
Christensen, Donna M., | Virgin Islands At-Large | D | 1510 LHOB | 202-225-1790 | Energy and Commerce |
Chu, Judy | California 27th District | D | 1520 LHOB | 202-225-5464 | Small Business the Judiciary |
Cicilline, David | Rhode Island 1st District | D | 128 CHOB | 202-225-4911 | Foreign Affairs the Judiciary |
Clark, Katherine | Massachusetts 5th District | D | 2108 RHOB | 202-225-2836 | Natural Resources Science, Space, and Technology |
Clarke, Yvette D. | New York 9th District | D | 2351 RHOB | 202-225-6231 | Ethics Homeland Security Small Business |
Clawson,Curt | Florida 19th District | R | 1123 LHOB | 202-225-2536 | |
Clay Jr., William “Lacy” | Missouri 1st District | D | 2418 RHOB | 202-225-2406 | Financial Services Oversight and Government |
Cleaver, Emanuel | Missouri 5th District | D | 2335 RHOB | 202-225-4535 | Financial Services |
Clyburn, James E. | South Carolina 6th District | D | 242 CHOB | 202-225-3315 | |
Coble, Howard | North Carolina 6th District | R | 2188 RHOB | 202-225-3065 | the Judiciary Transportation |
Coffman, Mike | Colorado 6th District | R | 2443 RHOB | 202-225-7882 | Armed Services Small Business Veterans’ Affairs |
Cohen, Steve | Tennessee 9th District | D | 2404 RHOB | 202-225-3265 | the Judiciary Transportation |
Cole, Tom | Oklahoma 4th District | R | 2458 RHOB | 202-225-6165 | Appropriations Joint Library Rules the Budget |
Collins, Chris | New York 27th District | R | 1117 LHOB | 202-225-5265 | Agriculture Science, Space, and Technology Small Business |
Collins, Doug | Georgia 9th District | R | 513 CHOB | 202-225-9893 | Foreign Affairs Oversight and Government the Judiciary |
Conaway, K. Michael | Texas 11th District | R | 2430 RHOB | 202-225-3605 | Agriculture Armed Services Ethics Intelligence (Permanent) |
Connolly, Gerald E. “Gerry” | Virginia 11th District | D | 424 CHOB | 202-225-1492 | Foreign Affairs Oversight and Government |
Conyers Jr., John | Michigan 13th District | D | 2426 RHOB | 202-225-5126 | the Judiciary |
Cook, Paul | California 8th District | R | 1222 LHOB | 202-225-5861 | Armed Services Foreign Affairs Veterans’ Affairs |
Cooper, Jim | Tennessee 5th District | D | 1536 LHOB | 202-225-4311 | Armed Services Oversight and Government |
Costa, Jim | California 16th District | D | 1314 LHOB | 202-225-3341 | Agriculture Natural Resources |
Cotton, Tom | Arkansas 4th District | R | 415 CHOB | 202-225-3772 | Financial Services Foreign Affairs |
Courtney, Joe | Connecticut 2nd District | D | 2348 RHOB | 202-225-2076 | Agriculture Armed Services Education and the Workforce |
Cramer, Kevin | North Dakota At-Large | R | 1032 LHOB | 202-225-2611 | Natural Resources Science, Space, and Technology |
Crawford, Rick | Arkansas 1st District | R | 1711 LHOB | 202-225-4076 | Agriculture Transportation |
Crenshaw, Ander | Florida 4th District | R | 440 CHOB | 202-225-2501 | Appropriations |
Crowley, Joseph | New York 14th District | D | 1436 LHOB | 202-225-3965 | Ways and Means |
Cuellar, Henry | Texas 28th District | D | 2431 RHOB | 202-225-1640 | Appropriations |
Culberson, John | Texas 7th District | R | 2352 RHOB | 202-225-2571 | Appropriations |
Cummings, Elijah | Maryland 7th District | D | 2235 RHOB | 202-225-4741 | Oversight and Government Transportation |
Cárdenas, Tony | California 29th District | D | 1508 LHOB | 202-225-6131 | Natural Resources Oversight and Government the Budget |
D
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Daines, Steve | Montana At-Large | R | 206 CHOB | 202-225-3211 | Homeland Security Natural Resources Transportation |
Davis, Danny K. | Illinois 7th District | D | 2159 RHOB | 202-225-5006 | Oversight and Government Ways and Means |
Davis, Rodney | Illinois 13th District | R | 1740 LHOB | 202-225-2371 | Agriculture Transportation |
Davis, Susan | California 53rd District | D | 1526 LHOB | 202-225-2040 | Armed Services Education and the Workforce |
DeFazio, Peter | Oregon 4th District | D | 2134 RHOB | 202-225-6416 | Natural Resources Transportation |
DeGette, Diana | Colorado 1st District | D | 2368 RHOB | 202-225-4431 | Energy and Commerce |
DeLauro, Rosa L. | Connecticut 3rd District | D | 2413 RHOB | 202-225-3661 | Appropriations |
DeSantis, Ron | Florida 6th District | R | 427 CHOB | 202-225-2706 | Foreign Affairs Oversight and Government the Judiciary |
DelBene, Suzan | Washington 1st District | D | 318 CHOB | 202-225-6311 | Agriculture the Judiciary |
Delaney, John | Maryland 6th District | D | 1632 LHOB | 202-225-2721 | Financial Services |
Denham, Jeff | California 10th District | R | 1730 LHOB | 202-225-4540 | Agriculture Transportation Veterans’ Affairs |
Dent, Charles W. | Pennsylvania 15th District | R | 2455 RHOB | 202-225-6411 | Appropriations Ethics |
DesJarlais, Scott | Tennessee 4th District | R | 413 CHOB | 202-225-6831 | Agriculture Education and the Workforce Oversight and Government |
Deutch, Ted | Florida 21st District | D | 1024 LHOB | 202-225-3001 | Ethics Foreign Affairs the Judiciary |
Diaz-Balart, Mario | Florida 25th District | R | 436 CHOB | 202-225-4211 | Appropriations |
Dingell, John | Michigan 12th District | D | 2328 RHOB | 202-225-4071 | Energy and Commerce |
Doggett, Lloyd | Texas 35th District | D | 201 CHOB | 202-225-4865 | the Budget Ways and Means |
Doyle, Mike | Pennsylvania 14th District | D | 239 CHOB | 202-225-2135 | Energy and Commerce |
Duckworth, Tammy | Illinois 8th District | D | 104 CHOB | 202-225-3711 | Armed Services Oversight and Government |
Duffy, Sean P. | Wisconsin 7th District | R | 1208 LHOB | 202-225-3365 | Financial Services Foreign Affairs the Budget |
Duncan Jr., John J. | Tennessee 2nd District | R | 2207 RHOB | 202-225-5435 | Oversight and Government Transportation |
Duncan, Jeff | South Carolina 3rd District | R | 116 CHOB | 202-225-5301 | Foreign Affairs Homeland Security Natural Resources |
E
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Edwards, Donna F. | Maryland 4th District | D | 2445 RHOB | 202-225-8699 | Science, Space, and Technology Transportation |
Ellison, Keith | Minnesota 5th District | D | 2244 RHOB | 202-225-4755 | Financial Services |
Ellmers, Renee | North Carolina 2nd District | R | 426 CHOB | 202-225-4531 | Energy and Commerce |
Engel, Eliot | New York 16th District | D | 2161 RHOB | 202-225-2464 | Energy and Commerce Foreign Affairs |
Enyart, William | Illinois 12th District | D | 1722 LHOB | 202-225-5661 | Agriculture Armed Services |
Eshoo, Anna G. | California 18th District | D | 241 CHOB | 202-225-8104 | Energy and Commerce |
Esty, Elizabeth | Connecticut 5th District | D | 509 CHOB | 202-225-4476 | Science, Space, and Technology Transportation |
F
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Faleomavaega, Eni F. H. | American Samoa At-Large | D | 2422 RHOB | 202-225-8577 | Foreign Affairs Natural Resources |
Farenthold, Blake | Texas 27th District | R | 117 CHOB | 202-225-7742 | Oversight and Government the Judiciary Transportation |
Farr, Sam | California 20th District | D | 1126 LHOB | 202-225-2861 | Appropriations |
Fattah, Chaka | Pennsylvania 2nd District | D | 2301 RHOB | 202-225-4001 | Appropriations |
Fincher, Stephen | Tennessee 8th District | R | 1118 LHOB | 202-225-4714 | Agriculture Financial Services |
Fitzpatrick, Michael G. | Pennsylvania 8th District | R | 2400 RHOB | 202-225-4276 | Financial Services |
Fleischmann, Chuck | Tennessee 3rd District | R | 230 CHOB | 202-225-3271 | Appropriations |
Fleming, John | Louisiana 4th District | R | 416 CHOB | 202-225-2777 | Armed Services Natural Resources |
Flores, Bill | Texas 17th District | R | 1030 LHOB | 202-225-6105 | Natural Resources the Budget Veterans’ Affairs |
Forbes, J. Randy | Virginia 4th District | R | 2135 RHOB | 202-225-6365 | Armed Services the Judiciary |
Fortenberry, Jeff | Nebraska 1st District | R | 1514 LHOB | 202-225-4806 | Appropriations |
Foster, Bill | Illinois 11th District | D | 1224 LHOB | 202-225-3515 | Financial Services |
Foxx, Virginia | North Carolina 5th District | R | 2350 RHOB | 202-225-2071 | Education and the Workforce Rules |
Frankel, Lois | Florida 22nd District | D | 1037 LHOB | 202-225-9890 | Foreign Affairs Transportation |
Franks, Trent | Arizona 8th District | R | 2435 RHOB | 202-225-4576 | Armed Services the Judiciary |
Frelinghuysen, Rodney | New Jersey 11th District | R | 2306 RHOB | 202-225-5034 | Appropriations |
Fudge, Marcia L. | Ohio 11th District | D | 2344 RHOB | 202-225-7032 | Agriculture Education and the Workforce |
G
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Gabbard, Tulsi | Hawaii 2nd District | D | 502 CHOB | 202-225-4906 | Armed Services Foreign Affairs |
Gallego, Pete | Texas 23rd District | D | 431 CHOB | 202-225-4511 | Agriculture Armed Services |
Garamendi, John | California 3rd District | D | 2438 RHOB | 202-225-1880 | Agriculture Armed Services Transportation |
Garcia, Joe | Florida 26th District | D | 1440 LHOB | 202-225-2778 | Natural Resources the Judiciary |
Gardner, Cory | Colorado 4th District | R | 213 CHOB | 202-225-4676 | Energy and Commerce |
Garrett, Scott | New Jersey 5th District | R | 2232 RHOB | 202-225-4465 | Financial Services the Budget |
Gerlach, Jim | Pennsylvania 6th District | R | 2442 RHOB | 202-225-4315 | Ways and Means |
Gibbs, Bob | Ohio 7th District | R | 329 CHOB | 202-225-6265 | Agriculture Transportation |
Gibson, Chris | New York 19th District | R | 1708 LHOB | 202-225-5614 | Agriculture Armed Services |
Gingrey, Phil | Georgia 11th District | R | 442 CHOB | 202-225-2931 | Energy and Commerce House Administration |
Gohmert, Louie | Texas 1st District | R | 2243 RHOB | 202-225-3035 | Natural Resources the Judiciary |
Goodlatte, Bob | Virginia 6th District | R | 2309 RHOB | 202-225-5431 | Agriculture the Judiciary |
Gosar, Paul A. | Arizona 4th District | R | 504 CHOB | 202-225-2315 | Natural Resources Oversight and Government |
Gowdy, Trey | South Carolina 4th District | R | 1404 LHOB | 202-225-6030 | Ethics Oversight and Government the Judiciary |
Granger, Kay | Texas 12th District | R | 1026 LHOB | 202-225-5071 | Appropriations |
Graves, Sam | Missouri 6th District | R | 1415 LHOB | 202-225-7041 | Small Business Transportation |
Graves, Tom | Georgia 14th District | R | 432 CHOB | 202-225-5211 | Appropriations |
Grayson, Alan | Florida 9th District | D | 430 CHOB | 202-225-9889 | Foreign Affairs Science, Space, and Technology |
Green, Al | Texas 9th District | D | 2201 RHOB | 202-225-7508 | Financial Services |
Green, Gene | Texas 29th District | D | 2470 RHOB | 202-225-1688 | Energy and Commerce |
Griffin, Tim | Arkansas 2nd District | R | 1232 LHOB | 202-225-2506 | Ways and Means |
Griffith, Morgan | Virginia 9th District | R | 1108 LHOB | 202-225-3861 | Energy and Commerce |
Grijalva, Raul | Arizona 3rd District | D | 1511 LHOB | 202-225-2435 | Education and the Workforce Natural Resources |
Grimm, Michael | New York 11th District | R | 512 CHOB | 202-225-3371 | |
Guthrie, S. Brett | Kentucky 2nd District | R | 308 CHOB | 202-225-3501 | Education and the Workforce Energy and Commerce |
Gutierrez, Luis | Illinois 4th District | D | 2408 RHOB | 202-225-8203 | Intelligence (Permanent) the Judiciary |
H
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Hahn, Janice | California 44th District | D | 404 CHOB | 202-225-8220 | Small Business Transportation |
Hall, Ralph M. | Texas 4th District | R | 2405 RHOB | 202-225-6673 | Energy and Commerce Science, Space, and Technology |
Hanabusa, Colleen | Hawaii 1st District | D | 238 CHOB | 202-225-2726 | Armed Services Natural Resources |
Hanna, Richard | New York 22nd District | R | 319 CHOB | 202-225-3665 | Small Business Transportation |
Harper, Gregg | Mississippi 3rd District | R | 307 CHOB | 202-225-5031 | Energy and Commerce House Administration Joint Library |
Harris, Andy | Maryland 1st District | R | 1533 LHOB | 202-225-5311 | Appropriations |
Hartzler, Vicky | Missouri 4th District | R | 1023 LHOB | 202-225-2876 | Agriculture Armed Services the Budget |
Hastings, Alcee L. | Florida 20th District | D | 2353 RHOB | 202-225-1313 | Rules |
Hastings, Doc | Washington 4th District | R | 1203 LHOB | 202-225-5816 | Natural Resources Oversight and Government |
Heck, Denny | Washington 10th District | D | 425 CHOB | 202-225-9740 | Financial Services |
Heck, Joe | Nevada 3rd District | R | 132 CHOB | 202-225-3252 | Armed Services Education and the Workforce Intelligence (Permanent) |
Hensarling, Jeb | Texas 5th District | R | 2228 RHOB | 202-225-3484 | Financial Services |
Herrera Beutler, Jaime | Washington 3rd District | R | 1130 LHOB | 202-225-3536 | Appropriations Small Business |
Higgins, Brian | New York 26th District | D | 2459 RHOB | 202-225-3306 | Foreign Affairs Homeland Security |
Himes, Jim | Connecticut 4th District | D | 119 CHOB | 202-225-5541 | Financial Services Intelligence (Permanent) |
Hinojosa, Rubén | Texas 15th District | D | 2262 RHOB | 202-225-2531 | Education and the Workforce Financial Services |
Holding, George | North Carolina 13th District | R | 507 CHOB | 202-225-3032 | Foreign Affairs the Judiciary |
Holt, Rush | New Jersey 12th District | D | 1214 LHOB | 202-225-5801 | Education and the Workforce Natural Resources |
Honda, Mike | California 17th District | D | 1713 LHOB | 202-225-2631 | Appropriations |
Horsford, Steven | Nevada 4th District | D | 1330 LHOB | 202-225-9894 | Financial Services Oversight and Government |
Hoyer, Steny H. | Maryland 5th District | D | 1705 LHOB | 202-225-4131 | |
Hudson, Richard | North Carolina 8th District | R | 429 CHOB | 202-225-3715 | Agriculture Education and the Workforce Homeland Security |
Huelskamp, Tim | Kansas 1st District | R | 129 CHOB | 202-225-2715 | Small Business Veterans’ Affairs |
Huffman, Jared | California 2nd District | D | 1630 LHOB | 202-225-5161 | Natural Resources the Budget |
Huizenga, Bill | Michigan 2nd District | R | 1217 LHOB | 202-225-4401 | Financial Services |
Hultgren, Randy | Illinois 14th District | R | 332 CHOB | 202-225-2976 | Financial Services Science, Space, and Technology |
Hunter, Duncan D. | California 50th District | R | 223 CHOB | 202-225-5672 | Armed Services Education and the Workforce Transportation |
Hurt, Robert | Virginia 5th District | R | 125 CHOB | 202-225-4711 | Financial Services |
I
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Israel, Steve | New York 3rd District | D | 2457 RHOB | 202-225-3335 | |
Issa, Darrell | California 49th District | R | 2347 RHOB | 202-225-3906 | Oversight and Government the Judiciary |
J
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Jackson Lee, Sheila | Texas 18th District | D | 2160 RHOB | 202-225-3816 | Homeland Security the Judiciary |
Jeffries, Hakeem | New York 8th District | D | 1339 LHOB | 202-225-5936 | the Budget the Judiciary |
Jenkins, Lynn | Kansas 2nd District | R | 1027 LHOB | 202-225-6601 | Ways and Means |
Johnson, Bill | Ohio 6th District | R | 1710 LHOB | 202-225-5705 | Energy and Commerce Science, Space, and Technology |
Johnson, Eddie Bernice | Texas 30th District | D | 2468 RHOB | 202-225-8885 | Science, Space, and Technology Transportation |
Johnson, Henry C. “Hank” Jr. | Georgia 4th District | D | 2240 RHOB | 202-225-1605 | Armed Services the Judiciary |
Johnson, Sam | Texas 3rd District | R | 1211 LHOB | 202-225-4201 | Joint Taxation Ways and Means |
Jolly, David | Florida 13th District | R | 2407 RHOB | 202-225-5961 | Transportation Veterans’ Affairs |
Jones, Walter B. | North Carolina 3rd District | R | 2333 RHOB | 202-225-3415 | Armed Services |
Jordan, Jim | Ohio 4th District | R | 1524 LHOB | 202-225-2676 | Oversight and Government the Judiciary |
Joyce, David | Ohio 14th District | R | 1535 LHOB | 202-225-5731 | Appropriations |
K
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Kaptur, Marcy | Ohio 9th District | D | 2186 RHOB | 202-225-4146 | Appropriations |
Keating, William | Massachusetts 9th District | D | 315 CHOB | 202-225-3111 | Foreign Affairs Homeland Security |
Kelly, Mike | Pennsylvania 3rd District | R | 1519 LHOB | 202-225-5406 | Education and the Workforce Ways and Means |
Kelly, Robin | Illinois 2nd District | D | 2419 RHOB | 202-225-0773 | Oversight and Government Science, Space, and Technology |
Kennedy III, Joseph P. | Massachusetts 4th District | D | 1218 LHOB | 202-225-5931 | Foreign Affairs Science, Space, and Technology |
Kildee, Daniel | Michigan 5th District | D | 327 CHOB | 202-225-3611 | Financial Services the Budget |
Kilmer, Derek | Washington 6th District | D | 1429 LHOB | 202-225-5916 | Armed Services Science, Space, and Technology |
Kind, Ron | Wisconsin 3rd District | D | 1502 LHOB | 202-225-5506 | Ways and Means |
King, Pete | New York 2nd District | R | 339 CHOB | 202-225-7896 | Financial Services Homeland Security Intelligence (Permanent) |
King, Steve | Iowa 4th District | R | 2210 RHOB | 202-225-4426 | Agriculture Small Business the Judiciary |
Kingston, Jack | Georgia 1st District | R | 2372 RHOB | 202-225-5831 | Appropriations |
Kinzinger, Adam | Illinois 16th District | R | 1221 LHOB | 202-225-3635 | Energy and Commerce Foreign Affairs |
Kirkpatrick, Ann | Arizona 1st District | D | 330 CHOB | 202-225-3361 | Transportation Veterans’ Affairs |
Kline, John | Minnesota 2nd District | R | 2439 RHOB | 202-225-2271 | Armed Services Education and the Workforce |
Kuster, Ann | New Hampshire 2nd District | D | 137 CHOB | 202-225-5206 | Agriculture Small Business Veterans’ Affairs |
L
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
LaMalfa, Doug | California 1st District | R | 506 CHOB | 202-225-3076 | Agriculture Natural Resources |
Labrador, Raul R. | Idaho 1st District | R | 1523 LHOB | 202-225-6611 | Natural Resources the Judiciary |
Lamborn, Doug | Colorado 5th District | R | 2402 RHOB | 202-225-4422 | Armed Services Natural Resources Veterans’ Affairs |
Lance, Leonard | New Jersey 7th District | R | 133 CHOB | 202-225-5361 | Energy and Commerce |
Langevin, Jim | Rhode Island 2nd District | D | 109 CHOB | 202-225-2735 | Armed Services Intelligence (Permanent) |
Lankford, James | Oklahoma 5th District | R | 228 CHOB | 202-225-2132 | Oversight and Government the Budget |
Larsen, Rick | Washington 2nd District | D | 2113 RHOB | 202-225-2605 | Armed Services Transportation |
Larson, John B. | Connecticut 1st District | D | 1501 LHOB | 202-225-2265 | Ways and Means |
Latham, Tom | Iowa 3rd District | R | 2217 RHOB | 202-225-5476 | Appropriations |
Latta, Robert E. | Ohio 5th District | R | 2448 RHOB | 202-225-6405 | Energy and Commerce |
Lee, Barbara | California 13th District | D | 2267 RHOB | 202-225-2661 | Appropriations the Budget |
Levin, Sander | Michigan 9th District | D | 1236 LHOB | 202-225-4961 | Joint Taxation Ways and Means |
Lewis, John | Georgia 5th District | D | 343 CHOB | 202-225-3801 | Ways and Means |
Lipinski, Daniel | Illinois 3rd District | D | 1717 LHOB | 202-225-5701 | Science, Space, and Technology Transportation |
LoBiondo, Frank | New Jersey 2nd District | R | 2427 RHOB | 202-225-6572 | Armed Services Intelligence (Permanent) Transportation |
Loebsack, David | Iowa 2nd District | D | 1527 LHOB | 202-225-6576 | Armed Services Education and the Workforce |
Lofgren, Zoe | California 19th District | D | 1401 LHOB | 202-225-3072 | House Administration Joint Library Science, Space, and Technology the Judiciary |
Long, Billy | Missouri 7th District | R | 1541 LHOB | 202-225-6536 | Energy and Commerce |
Lowenthal, Alan | California 47th District | D | 515 CHOB | 202-225-7924 | Foreign Affairs Natural Resources |
Lowey, Nita | New York 17th District | D | 2365 RHOB | 202-225-6506 | Appropriations |
Lucas, Frank | Oklahoma 3rd District | R | 2311 RHOB | 202-225-5565 | Agriculture Financial Services Science, Space, and Technology |
Luetkemeyer, Blaine | Missouri 3rd District | R | 2440 RHOB | 202-225-2956 | Financial Services Small Business |
Lujan Grisham, Michelle | New Mexico 1st District | D | 214 CHOB | 202-225-6316 | Agriculture Oversight and Government the Budget |
Lujan, Ben R. | New Mexico 3rd District | D | 2446 RHOB | 202-225-6190 | Energy and Commerce |
Lummis, Cynthia M. | Wyoming At-Large | R | 113 CHOB | 202-225-2311 | Natural Resources Oversight and Government Science, Space, and Technology |
Lynch, Stephen F. | Massachusetts 8th District | D | 2133 RHOB | 202-225-8273 | Financial Services Oversight and Government |
M
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Maffei, Daniel | New York 24th District | D | 422 CHOB | 202-225-3701 | Armed Services Science, Space, and Technology |
Maloney, Carolyn | New York 12th District | D | 2308 RHOB | 202-225-7944 | Financial Services Oversight and Government |
Maloney, Sean Patrick | New York 18th District | D | 1529 LHOB | 202-225-5441 | Agriculture Transportation |
Marchant, Kenny | Texas 24th District | R | 1110 LHOB | 202-225-6605 | Education and the Workforce Ways and Means |
Marino, Tom | Pennsylvania 10th District | R | 410 CHOB | 202-225-3731 | Foreign Affairs Homeland Security the Judiciary |
Massie, Thomas | Kentucky 4th District | R | 314 CHOB | 202-225-3465 | Oversight and Government Science, Space, and Technology Transportation |
Matheson, Jim | Utah 4th District | D | 2211 RHOB | 202-225-3011 | Energy and Commerce |
Matsui, Doris O. | California 6th District | D | 2434 RHOB | 202-225-7163 | Energy and Commerce |
McAllister, Vance | Louisiana 5th District | R | 316 CHOB | 202-225-8490 | Agriculture Natural Resources |
McCarthy, Carolyn | New York 4th District | D | 2346 RHOB | 202-225-5516 | Education and the Workforce Financial Services |
McCarthy, Kevin | California 23rd District | R | 2421 RHOB | 202-225-2915 | Financial Services |
McCaul, Michael T. | Texas 10th District | R | 131 CHOB | 202-225-2401 | Foreign Affairs Homeland Security Science, Space, and Technology |
McClintock, Tom | California 4th District | R | 434 CHOB | 202-225-2511 | Natural Resources the Budget |
McCollum, Betty | Minnesota 4th District | D | 1714 LHOB | 202-225-6631 | Appropriations |
McDermott, Jim | Washington 7th District | D | 1035 LHOB | 202-225-3106 | the Budget Ways and Means |
McGovern, James | Massachusetts 2nd District | D | 438 CHOB | 202-225-6101 | Agriculture Rules |
McHenry, Patrick T. | North Carolina 10th District | R | 2334 RHOB | 202-225-2576 | Financial Services Oversight and Government |
McIntyre, Mike | North Carolina 7th District | D | 2428 RHOB | 202-225-2731 | Agriculture Armed Services |
McKeon, Buck | California 25th District | R | 2310 RHOB | 202-225-1956 | Armed Services Education and the Workforce |
McKinley, David | West Virginia 1st District | R | 412 CHOB | 202-225-4172 | Energy and Commerce |
McMorris Rodgers, Cathy | Washington 5th District | R | 203 CHOB | 202-225-2006 | Energy and Commerce |
McNerney, Jerry | California 9th District | D | 1210 LHOB | 202-225-1947 | Energy and Commerce |
Meadows, Mark | North Carolina 11th District | R | 1516 LHOB | 202-225-6401 | Foreign Affairs Oversight and Government Transportation |
Meehan, Pat | Pennsylvania 7th District | R | 204 CHOB | 202-225-2011 | Ethics Homeland Security Oversight and Government Transportation |
Meeks, Gregory W. | New York 5th District | D | 2234 RHOB | 202-225-3461 | Financial Services Foreign Affairs |
Meng, Grace | New York 6th District | D | 1317 LHOB | 202-225-2601 | Foreign Affairs Small Business |
Messer, Luke | Indiana 6th District | R | 508 CHOB | 202-225-3021 | Education and the Workforce Financial Services |
Mica, John | Florida 7th District | R | 2187 RHOB | 202-225-4035 | Oversight and Government Transportation |
Michaud, Michael | Maine 2nd District | D | 1724 LHOB | 202-225-6306 | Transportation Veterans’ Affairs |
Miller, Candice | Michigan 10th District | R | 320 CHOB | 202-225-2106 | Homeland Security House Administration Joint Library Transportation |
Miller, Gary | California 31st District | R | 2467 RHOB | 202-225-3201 | Financial Services Transportation |
Miller, George | California 11th District | D | 2205 RHOB | 202-225-2095 | Education and the Workforce |
Miller, Jeff | Florida 1st District | R | 336 CHOB | 202-225-4136 | Armed Services Intelligence (Permanent) Veterans’ Affairs |
Moore, Gwen | Wisconsin 4th District | D | 2245 RHOB | 202-225-4572 | Financial Services the Budget |
Moran, James | Virginia 8th District | D | 2252 RHOB | 202-225-4376 | Appropriations |
Mullin, Markwayne | Oklahoma 2nd District | R | 1113 LHOB | 202-225-2701 | Natural Resources Transportation |
Mulvaney, Mick | South Carolina 5th District | R | 1207 LHOB | 202-225-5501 | Financial Services Small Business |
Murphy, Patrick | Florida 18th District | D | 1517 LHOB | 202-225-3026 | Financial Services Small Business |
Murphy, Tim | Pennsylvania 18th District | R | 2332 RHOB | 202-225-2301 | Energy and Commerce |
N
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Nadler, Jerrold | New York 10th District | D | 2110 RHOB | 202-225-5635 | the Judiciary Transportation |
Napolitano, Grace | California 32nd District | D | 1610 LHOB | 202-225-5256 | Natural Resources Transportation |
Neal, Richard E. | Massachusetts 1st District | D | 2208 RHOB | 202-225-5601 | Ways and Means |
Negrete McLeod, Gloria | California 35th District | D | 1641 LHOB | 202-225-6161 | Agriculture Veterans’ Affairs |
Neugebauer, Randy | Texas 19th District | R | 1424 LHOB | 202-225-4005 | Agriculture Financial Services Science, Space, and Technology |
Noem, Kristi | South Dakota At-Large | R | 1323 LHOB | 202-225-2801 | Agriculture Armed Services |
Nolan, Rick | Minnesota 8th District | D | 2447 RHOB | 202-225-6211 | Agriculture Transportation |
Norton, Eleanor Holmes | District of Columbia At-Large | D | 2136 RHOB | 202-225-8050 | Oversight and Government Transportation |
Nugent, Richard | Florida 11th District | R | 1727 LHOB | 202-225-1002 | Armed Services House Administration Rules |
Nunes, Devin | California 22nd District | R | 1013 LHOB | 202-225-2523 | Intelligence (Permanent) Ways and Means |
Nunnelee, Alan | Mississippi 1st District | R | 1427 LHOB | 202-225-4306 | Appropriations the Budget |
O
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
O’Rourke, Beto | Texas 16th District | D | 1721 LHOB | 202-225-4831 | Homeland Security Veterans’ Affairs |
Olson, Pete | Texas 22nd District | R | 312 CHOB | 202-225-5951 | Energy and Commerce |
Owens, Bill | New York 21st District | D | 405 CHOB | 202-225-4611 | Appropriations |
P
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Palazzo, Steven | Mississippi 4th District | R | 331 CHOB | 202-225-5772 | Armed Services Homeland Security Science, Space, and Technology |
Pallone Jr., Frank | New Jersey 6th District | D | 237 CHOB | 202-225-4671 | Energy and Commerce Natural Resources |
Pascrell Jr., Bill | New Jersey 9th District | D | 2370 RHOB | 202-225-5751 | the Budget Ways and Means |
Pastor, Ed | Arizona 7th District | D | 2465 RHOB | 202-225-4065 | Appropriations Intelligence (Permanent) |
Paulsen, Erik | Minnesota 3rd District | R | 127 CHOB | 202-225-2871 | Ways and Means |
Payne Jr., Donald | New Jersey 10th District | D | 103 CHOB | 202-225-3436 | Homeland Security Small Business |
Pearce, Steve | New Mexico 2nd District | R | 2432 RHOB | 202-225-2365 | Financial Services |
Pelosi, Nancy | California 12th District | D | 235 CHOB | 202-225-4965 | |
Perlmutter, Ed | Colorado 7th District | D | 1410 LHOB | 202-225-2645 | Financial Services |
Perry, Scott | Pennsylvania 4th District | R | 126 CHOB | 202-225-5836 | Foreign Affairs Homeland Security Transportation |
Peters, Gary | Michigan 14th District | D | 1609 LHOB | 202-225-5802 | Financial Services |
Peters, Scott | California 52nd District | D | 2410 RHOB | 202-225-0508 | Armed Services Science, Space, and Technology |
Peterson, Collin C. | Minnesota 7th District | D | 2109 RHOB | 202-225-2165 | Agriculture |
Petri, Thomas | Wisconsin 6th District | R | 2462 RHOB | 202-225-2476 | Education and the Workforce Transportation |
Pierluisi, Pedro | Puerto Rico At-Large | D | 1213 LHOB | 202-225-2615 | Ethics Natural Resources the Judiciary |
Pingree, Chellie | Maine 1st District | D | 1318 LHOB | 202-225-6116 | Appropriations |
Pittenger, Robert | North Carolina 9th District | R | 224 CHOB | 202-225-1976 | Financial Services |
Pitts, Joseph R. | Pennsylvania 16th District | R | 420 CHOB | 202-225-2411 | Energy and Commerce |
Pocan, Mark | Wisconsin 2nd District | D | 313 CHOB | 202-225-2906 | Education and the Workforce the Budget |
Poe, Ted | Texas 2nd District | R | 2412 RHOB | 202-225-6565 | Foreign Affairs the Judiciary |
Polis, Jared | Colorado 2nd District | D | 1433 LHOB | 202-225-2161 | Education and the Workforce Rules |
Pompeo, Mike | Kansas 4th District | R | 107 CHOB | 202-225-6216 | Energy and Commerce Intelligence (Permanent) |
Posey, Bill | Florida 8th District | R | 120 CHOB | 202-225-3671 | Financial Services Science, Space, and Technology |
Price, David | North Carolina 4th District | D | 2162 RHOB | 202-225-1784 | Appropriations |
Price, Tom | Georgia 6th District | R | 100 CHOB | 202-225-4501 | Education and the Workforce the Budget Ways and Means |
Q
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Quigley, Mike | Illinois 5th District | D | 1124 LHOB | 202-225-4061 | Appropriations |
R
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Rahall, Nick | West Virginia 3rd District | D | 2307 RHOB | 202-225-3452 | Transportation |
Rangel, Charles B. | New York 13th District | D | 2354 RHOB | 202-225-4365 | Joint Taxation Ways and Means |
Reed, Tom | New York 23rd District | R | 1504 LHOB | 202-225-3161 | Ways and Means |
Reichert, David G. | Washington 8th District | R | 1127 LHOB | 202-225-7761 | Ways and Means |
Renacci, Jim | Ohio 16th District | R | 130 CHOB | 202-225-3876 | Ways and Means |
Ribble, Reid | Wisconsin 8th District | R | 1513 LHOB | 202-225-5665 | Agriculture the Budget Transportation |
Rice, Tom | South Carolina 7th District | R | 325 CHOB | 202-225-9895 | Small Business the Budget Transportation |
Richmond, Cedric | Louisiana 2nd District | D | 240 CHOB | 202-225-6636 | Homeland Security the Judiciary |
Rigell, Scott | Virginia 2nd District | R | 418 CHOB | 202-225-4215 | Armed Services the Budget |
Roby, Martha | Alabama 2nd District | R | 428 CHOB | 202-225-2901 | Appropriations |
Roe, Phil | Tennessee 1st District | R | 407 CHOB | 202-225-6356 | Education and the Workforce Veterans’ Affairs |
Rogers (AL), Mike | Alabama 3rd District | R | 324 CHOB | 202-225-3261 | Agriculture Armed Services Homeland Security |
Rogers (MI), Mike | Michigan 8th District | R | 2112 RHOB | 202-225-4872 | Energy and Commerce Intelligence (Permanent) |
Rogers, Harold | Kentucky 5th District | R | 2406 RHOB | 202-225-4601 | Appropriations |
Rohrabacher, Dana | California 48th District | R | 2300 RHOB | 202-225-2415 | Foreign Affairs Science, Space, and Technology |
Rokita, Todd | Indiana 4th District | R | 236 CHOB | 202-225-5037 | Education and the Workforce House Administration the Budget |
Rooney, Tom | Florida 17th District | R | 221 CHOB | 202-225-5792 | Appropriations Intelligence (Permanent) |
Ros-Lehtinen, Ileana | Florida 27th District | R | 2206 RHOB | 202-225-3931 | Foreign Affairs Rules |
Roskam, Peter J. | Illinois 6th District | R | 227 CHOB | 202-225-4561 | Ways and Means |
Ross, Dennis | Florida 15th District | R | 229 CHOB | 202-225-1252 | Financial Services |
Rothfus, Keith | Pennsylvania 12th District | R | 503 CHOB | 202-225-2065 | Financial Services |
Roybal-Allard, Lucille | California 40th District | D | 2330 RHOB | 202-225-1766 | Appropriations |
Royce, Ed | California 39th District | R | 2185 RHOB | 202-225-4111 | Financial Services Foreign Affairs |
Ruiz, Raul | California 36th District | D | 1319 LHOB | 202-225-5330 | Natural Resources Veterans’ Affairs |
Runyan, Jon | New Jersey 3rd District | R | 1239 LHOB | 202-225-4765 | Armed Services Natural Resources Veterans’ Affairs |
Ruppersberger, Dutch | Maryland 2nd District | D | 2416 RHOB | 202-225-3061 | Intelligence (Permanent) |
Rush, Bobby L. | Illinois 1st District | D | 2268 RHOB | 202-225-4372 | Energy and Commerce |
Ryan, Paul | Wisconsin 1st District | R | 1233 LHOB | 202-225-3031 | the Budget Ways and Means |
Ryan, Tim | Ohio 13th District | D | 1421 LHOB | 202-225-5261 | Appropriations the Budget |
S
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Sablan, Gregorio | Northern Mariana Islands At-Large | D | 423 CHOB | 202-225-2646 | Education and the Workforce Natural Resources |
Salmon, Matt | Arizona 5th District | R | 2349 RHOB | 202-225-2635 | Education and the Workforce Foreign Affairs |
Sanchez, Linda | California 38th District | D | 2423 RHOB | 202-225-6676 | Ethics Ways and Means |
Sanchez, Loretta | California 46th District | D | 1114 LHOB | 202-225-2965 | Armed Services Homeland Security |
Sanford, Mark | South Carolina 1st District | R | 322 CHOB | 202-225-3176 | Homeland Security Transportation |
Sarbanes, John P. | Maryland 3rd District | D | 2444 RHOB | 202-225-4016 | Energy and Commerce |
Scalise, Steve | Louisiana 1st District | R | 2338 RHOB | 202-225-3015 | Energy and Commerce |
Schakowsky, Jan | Illinois 9th District | D | 2367 RHOB | 202-225-2111 | Energy and Commerce Intelligence (Permanent) |
Schiff, Adam | California 28th District | D | 2411 RHOB | 202-225-4176 | Appropriations Intelligence (Permanent) |
Schneider, Brad | Illinois 10th District | D | 317 CHOB | 202-225-4835 | Foreign Affairs Small Business |
Schock, Aaron | Illinois 18th District | R | 328 CHOB | 202-225-6201 | House Administration Ways and Means |
Schrader, Kurt | Oregon 5th District | D | 108 CHOB | 202-225-5711 | Agriculture Small Business the Budget |
Schwartz, Allyson Y. | Pennsylvania 13th District | D | 1227 LHOB | 202-225-6111 | Ways and Means |
Schweikert, David | Arizona 6th District | R | 1205 LHOB | 202-225-2190 | Science, Space, and Technology Small Business |
Scott, Austin | Georgia 8th District | R | 516 CHOB | 202-225-6531 | Agriculture Armed Services |
Scott, David | Georgia 13th District | D | 225 CHOB | 202-225-2939 | Agriculture Financial Services |
Scott, Robert C. | Virginia 3rd District | D | 1201 LHOB | 202-225-8351 | Education and the Workforce the Judiciary |
Sensenbrenner, F. James | Wisconsin 5th District | R | 2449 RHOB | 202-225-5101 | Science, Space, and Technology the Judiciary |
Serrano, José E. | New York 15th District | D | 2227 RHOB | 202-225-4361 | Appropriations |
Sessions, Pete | Texas 32nd District | R | 2233 RHOB | 202-225-2231 | Rules |
Sewell, Terri A. | Alabama 7th District | D | 1133 LHOB | 202-225-2665 | Financial Services Intelligence (Permanent) |
Shea-Porter, Carol | New Hampshire 1st District | D | 1530 LHOB | 202-225-5456 | Armed Services Natural Resources |
Sherman, Brad | California 30th District | D | 2242 RHOB | 202-225-5911 | Financial Services Foreign Affairs |
Shimkus, John | Illinois 15th District | R | 2452 RHOB | 202-225-5271 | Energy and Commerce |
Shuster, Bill | Pennsylvania 9th District | R | 2209 RHOB | 202-225-2431 | Armed Services Transportation |
Simpson, Mike | Idaho 2nd District | R | 2312 RHOB | 202-225-5531 | Appropriations |
Sinema, Kyrsten | Arizona 9th District | D | 1237 LHOB | 202-225-9888 | Financial Services |
Sires, Albio | New Jersey 8th District | D | 2342 RHOB | 202-225-7919 | Foreign Affairs Transportation |
Slaughter, Louise | New York 25th District | D | 2469 RHOB | 202-225-3615 | Rules |
Smith, Adam | Washington 9th District | D | 2264 RHOB | 202-225-8901 | Armed Services |
Smith, Adrian | Nebraska 3rd District | R | 2241 RHOB | 202-225-6435 | Ways and Means |
Smith, Chris | New Jersey 4th District | R | 2373 RHOB | 202-225-3765 | Foreign Affairs |
Smith, Jason | Missouri 8th District | R | 2230 RHOB | 202-225-4404 | Natural Resources the Judiciary |
Smith, Lamar | Texas 21st District | R | 2409 RHOB | 202-225-4236 | Homeland Security Science, Space, and Technology the Judiciary |
Southerland, Steve | Florida 2nd District | R | 1229 LHOB | 202-225-5235 | Natural Resources Transportation |
Speier, Jackie | California 14th District | D | 211 CHOB | 202-225-3531 | Armed Services Oversight and Government |
Stewart, Chris | Utah 2nd District | R | 323 CHOB | 202-225-9730 | Appropriations |
Stivers, Steve | Ohio 15th District | R | 1022 LHOB | 202-225-2015 | Financial Services |
Stockman, Steve | Texas 36th District | R | 326 CHOB | 202-225-1555 | Foreign Affairs Science, Space, and Technology |
Stutzman, Marlin | Indiana 3rd District | R | 1728 LHOB | 202-225-4436 | Financial Services |
Swalwell, Eric | California 15th District | D | 501 CHOB | 202-225-5065 | Homeland Security Science, Space, and Technology |
T
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Takano, Mark | California 41st District | D | 1507 LHOB | 202-225-2305 | Education and the Workforce Veterans’ Affairs |
Terry, Lee | Nebraska 2nd District | R | 2266 RHOB | 202-225-4155 | Energy and Commerce |
Thompson, Bennie G. | Mississippi 2nd District | D | 2466 RHOB | 202-225-5876 | Homeland Security |
Thompson, Glenn W. | Pennsylvania 5th District | R | 124 CHOB | 202-225-5121 | Agriculture Education and the Workforce Natural Resources |
Thompson, Mike | California 5th District | D | 231 CHOB | 202-225-3311 | Intelligence (Permanent) Ways and Means |
Thornberry, Mac | Texas 13th District | R | 2329 RHOB | 202-225-3706 | Armed Services Intelligence (Permanent) |
Tiberi, Pat | Ohio 12th District | R | 106 CHOB | 202-225-5355 | Ways and Means |
Tierney, John | Massachusetts 6th District | D | 2238 RHOB | 202-225-8020 | Education and the Workforce Oversight and Government |
Tipton, Scott | Colorado 3rd District | R | 218 CHOB | 202-225-4761 | Agriculture Natural Resources Small Business |
Titus, Dina | Nevada 1st District | D | 401 CHOB | 202-225-5965 | Transportation Veterans’ Affairs |
Tonko, Paul D. | New York 20th District | D | 2463 RHOB | 202-225-5076 | Energy and Commerce |
Tsongas, Niki | Massachusetts 3rd District | D | 1607 LHOB | 202-225-3411 | Armed Services Natural Resources |
Turner, Michael | Ohio 10th District | R | 2239 RHOB | 202-225-6465 | Armed Services Oversight and Government |
U
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Upton, Fred | Michigan 6th District | R | 2183 RHOB | 202-225-3761 | Energy and Commerce |
V
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Valadao, David | California 21st District | R | 1004 LHOB | 202-225-4695 | Appropriations |
Van Hollen, Chris | Maryland 8th District | D | 1707 LHOB | 202-225-5341 | the Budget |
Vargas, Juan | California 51st District | D | 1605 LHOB | 202-225-8045 | Agriculture Foreign Affairs House Administration |
Veasey, Marc | Texas 33rd District | D | 414 CHOB | 202-225-9897 | Armed Services Science, Space, and Technology |
Vela, Filemon | Texas 34th District | D | 437 CHOB | 202-225-9901 | Agriculture Homeland Security |
Velázquez, Nydia M. | New York 7th District | D | 2302 RHOB | 202-225-2361 | Financial Services Small Business |
Visclosky, Peter | Indiana 1st District | D | 2256 RHOB | 202-225-2461 | Appropriations |
W
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Wagner, Ann | Missouri 2nd District | R | 435 CHOB | 202-225-1621 | Financial Services |
Walberg, Tim | Michigan 7th District | R | 2436 RHOB | 202-225-6276 | Education and the Workforce Oversight and Government |
Walden, Greg | Oregon 2nd District | R | 2182 RHOB | 202-225-6730 | Energy and Commerce |
Walorski, Jackie | Indiana 2nd District | R | 419 CHOB | 202-225-3915 | Armed Services the Budget Veterans’ Affairs |
Walz, Timothy J. | Minnesota 1st District | D | 1034 LHOB | 202-225-2472 | Agriculture Transportation Veterans’ Affairs |
Wasserman Schultz, Debbie | Florida 23rd District | D | 118 CHOB | 202-225-7931 | Appropriations |
Waters, Maxine | California 43rd District | D | 2221 RHOB | 202-225-2201 | Financial Services |
Watt, Mel — Vacancy | North Carolina 12th District | D | 2304 RHOB | 202-225-1510 | |
Waxman, Henry | California 33rd District | D | 2204 RHOB | 202-225-3976 | Energy and Commerce |
Weber, Randy | Texas 14th District | R | 510 CHOB | 202-225-2831 | Foreign Affairs Science, Space, and Technology |
Webster, Daniel | Florida 10th District | R | 1039 LHOB | 202-225-2176 | Rules Transportation |
Welch, Peter | Vermont At-Large | D | 2303 RHOB | 202-225-4115 | Energy and Commerce Oversight and Government |
Wenstrup, Brad | Ohio 2nd District | R | 1223 LHOB | 202-225-3164 | Armed Services Veterans’ Affairs |
Westmoreland, Lynn A. | Georgia 3rd District | R | 2433 RHOB | 202-225-5901 | Financial Services Intelligence (Permanent) |
Whitfield, Ed | Kentucky 1st District | R | 2184 RHOB | 202-225-3115 | Energy and Commerce |
Williams, Roger | Texas 25th District | R | 1122 LHOB | 202-225-9896 | the Budget Transportation |
Wilson, Frederica | Florida 24th District | D | 208 CHOB | 202-225-4506 | Education and the Workforce Science, Space, and Technology |
Wilson, Joe | South Carolina 2nd District | R | 2229 RHOB | 202-225-2452 | Armed Services Education and the Workforce Foreign Affairs |
Wittman, Robert J. | Virginia 1st District | R | 2454 RHOB | 202-225-4261 | Armed Services Natural Resources |
Wolf, Frank | Virginia 10th District | R | 233 CHOB | 202-225-5136 | Appropriations |
Womack, Steve | Arkansas 3rd District | R | 1119 LHOB | 202-225-4301 | Appropriations |
Woodall, Robert | Georgia 7th District | R | 1725 LHOB | 202-225-4272 | Oversight and Government Rules the Budget |
Y
Name | District | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
Yarmuth, John A. | Kentucky 3rd District | D | 403 CHOB | 202-225-5401 | Energy and Commerce the Budget |
Yoder, Kevin | Kansas 3rd District | R | 215 CHOB | 202-225-2865 | Appropriations |
Yoho, Ted | Florida 3rd District | R | 511 CHOB | 202-225-5744 | Agriculture Foreign Affairs |
Young, Don | Alaska At-Large | R | 2314 RHOB | 202-225-5765 | Natural Resources Transportation |
Young, Todd | Indiana 9th District | R | 1007 LHOB | 202-225-5315 | Ways and Means |
A Note About Room Numbering
The three primary House office buildings—Cannon, Longworth and Rayburn—share a room numbering system for above-ground rooms that might confuse visitors at first. The system is fairly straight forward and can be used to identify most member and committee offices merely by knowing the correct room number regardless of building.
All Cannon above-ground rooms are three digits. As you would expect, the first digit indicates the floor level. For example, 303 Cannon is on the 3rd floor.
All above-ground Longworth rooms are four digits and start with the number 1. The second digit from the left indicates the floor. For example, 1309 is on the third floor of the Longworth building.
All above-ground Rayburn rooms are also four digits, but start with a 2. The second digit indicates the floor number. For example, 2125 is on the first floor of Rayburn.
Posted by Jane Gyorgy on July 10, 2014
https://oysterzone.wordpress.com/2014/07/10/07-10-2014-how-to-contact-any-congress-person/
07-10-14 HOW TO CONTACT YOUR CALIFORNIA CONGRESSMEN AND WOMEN
http://www.house.gov/representatives/#state_ca
California
District | Name | Party | Room | Phone | Committee Assignment |
---|---|---|---|---|---|
1 | LaMalfa, Doug | R | 506 CHOB | 202-225-3076 | Agriculture Natural Resources |
2 | Huffman, Jared | D | 1630 LHOB | 202-225-5161 | Natural Resources the Budget |
3 | Garamendi, John | D | 2438 RHOB | 202-225-1880 | Agriculture Armed Services Transportation |
4 | McClintock, Tom | R | 434 CHOB | 202-225-2511 | Natural Resources the Budget |
5 | Thompson, Mike | D | 231 CHOB | 202-225-3311 | Intelligence (Permanent) Ways and Means |
6 | Matsui, Doris O. | D | 2434 RHOB | 202-225-7163 | Energy and Commerce |
7 | Bera, Ami | D | 1408 LHOB | 202-225-5716 | Foreign Affairs Science, Space, and Technology |
8 | Cook, Paul | R | 1222 LHOB | 202-225-5861 | Armed Services Foreign Affairs Veterans’ Affairs |
9 | McNerney, Jerry | D | 1210 LHOB | 202-225-1947 | Energy and Commerce |
10 | Denham, Jeff | R | 1730 LHOB | 202-225-4540 | Agriculture Transportation Veterans’ Affairs |
11 | Miller, George | D | 2205 RHOB | 202-225-2095 | Education and the Workforce |
12 | Pelosi, Nancy | D | 235 CHOB | 202-225-4965 | |
13 | Lee, Barbara | D | 2267 RHOB | 202-225-2661 | Appropriations the Budget |
14 | Speier, Jackie | D | 211 CHOB | 202-225-3531 | Armed Services Oversight and Government |
15 | Swalwell, Eric | D | 501 CHOB | 202-225-5065 | Homeland Security Science, Space, and Technology |
16 | Costa, Jim | D | 1314 LHOB | 202-225-3341 | Agriculture Natural Resources |
17 | Honda, Mike | D | 1713 LHOB | 202-225-2631 | Appropriations |
18 | Eshoo, Anna G. | D | 241 CHOB | 202-225-8104 | Energy and Commerce |
19 | Lofgren, Zoe | D | 1401 LHOB | 202-225-3072 | House Administration Joint Library Science, Space, and Technology the Judiciary |
20 | Farr, Sam | D | 1126 LHOB | 202-225-2861 | Appropriations |
21 | Valadao, David | R | 1004 LHOB | 202-225-4695 | Appropriations |
22 | Nunes, Devin | R | 1013 LHOB | 202-225-2523 | Intelligence (Permanent) Ways and Means |
23 | McCarthy, Kevin | R | 2421 RHOB | 202-225-2915 | Financial Services |
24 | Capps, Lois | D | 2231 RHOB | 202-225-3601 | Energy and Commerce |
25 | McKeon, Buck | R | 2310 RHOB | 202-225-1956 | Armed Services Education and the Workforce |
26 | Brownley, Julia | D | 1019 LHOB | 202-225-5811 | Science, Space, and Technology Veterans’ Affairs |
27 | Chu, Judy | D | 1520 LHOB | 202-225-5464 | Small Business the Judiciary |
28 | Schiff, Adam | D | 2411 RHOB | 202-225-4176 | Appropriations Intelligence (Permanent) |
29 | Cárdenas, Tony | D | 1508 LHOB | 202-225-6131 | Natural Resources Oversight and Government the Budget |
30 | Sherman, Brad | D | 2242 RHOB | 202-225-5911 | Financial Services Foreign Affairs |
31 | Miller, Gary | R | 2467 RHOB | 202-225-3201 | Financial Services Transportation |
32 | Napolitano, Grace | D | 1610 LHOB | 202-225-5256 | Natural Resources Transportation |
33 | Waxman, Henry | D | 2204 RHOB | 202-225-3976 | Energy and Commerce |
34 | Becerra, Xavier | D | 1226 LHOB | 202-225-6235 | Ways and Means |
35 | Negrete McLeod, Gloria | D | 1641 LHOB | 202-225-6161 | Agriculture Veterans’ Affairs |
36 | Ruiz, Raul | D | 1319 LHOB | 202-225-5330 | Natural Resources Veterans’ Affairs |
37 | Bass, Karen | D | 408 CHOB | 202-225-7084 | Foreign Affairs the Judiciary |
38 | Sanchez, Linda | D | 2423 RHOB | 202-225-6676 | Ethics Ways and Means |
39 | Royce, Ed | R | 2185 RHOB | 202-225-4111 | Financial Services Foreign Affairs |
40 | Roybal-Allard, Lucille | D | 2330 RHOB | 202-225-1766 | Appropriations |
41 | Takano, Mark | D | 1507 LHOB | 202-225-2305 | Education and the Workforce Veterans’ Affairs |
42 | Calvert, Ken | R | 2269 RHOB | 202-225-1986 | Appropriations the Budget |
43 | Waters, Maxine | D | 2221 RHOB | 202-225-2201 | Financial Services |
44 | Hahn, Janice | D | 404 CHOB | 202-225-8220 | Small Business Transportation |
45 | Campbell, John | R | 2331 RHOB | 202-225-5611 | Financial Services the Budget |
46 | Sanchez, Loretta | D | 1114 LHOB | 202-225-2965 | Armed Services Homeland Security |
47 | Lowenthal, Alan | D | 515 CHOB | 202-225-7924 | Foreign Affairs Natural Resources |
48 | Rohrabacher, Dana | R | 2300 RHOB | 202-225-2415 | Foreign Affairs Science, Space, and Technology |
49 | Issa, Darrell | R | 2347 RHOB | 202-225-3906 | Oversight and Government the Judiciary |
50 | Hunter, Duncan D. | R | 223 CHOB | 202-225-5672 | Armed Services Education and the Workforce Transportation |
51 | Vargas, Juan | D | 1605 LHOB | 202-225-8045 | Agriculture Foreign Affairs House Administration |
52 | Peters, Scott | D | 2410 RHOB | 202-225-0508 | Armed Services Science, Space, and Technology |
53 | Davis, Susan | D | 1526 LHOB | 202-225-2040 | Armed Services Education and the Workforce |
Posted by Jane Gyorgy on July 10, 2014
https://oysterzone.wordpress.com/2014/07/10/07-10-14-how-to-contact-your-california-congressmen-and-women/
06-27-14 WSJ: Oyster Farm Digs in for High Court Hearing
Oyster Farm Digs in for High Court Hearing
“The oyster farm’s owners, Kevin Lunny and his family, have staved off closure so far by appealing the decision in the federal courts. They are now waiting to learn whether the U.S. Supreme Court will hear their case.
If the answer is yes, it would allow the Lunnys at least a few more months to continue their business, which employs 25 people and produces about a third of California-harvested oysters. The court’s decision on whether to hear the case next fall could be posted on its website Monday.
Amid the uncertainty, Mr. Lunny said he has reduced his staffing from 30 to 25, mostly through attrition. While he remains hopeful of ultimately winning the fight, he said it has taken a toll on him.
“The government is a powerful group to be up against,” said Mr. Lunny, who is being represented by pro bono attorneys. “They have unlimited resources and they just line up the lawyers.”
Businessman Staves Off Closure as Clock Runs Out on Lease in Wilderness-Designated Area Along California Coast
By Jim Carlton
June 27, 2014 7:03 p.m. ET
POINT REYES NATIONAL SEASHORE, Calif.—Bill Fischer has been making a trek to buy freshly harvested oysters along the Marin County coast here for 60 years.
“These are some of the best oysters anywhere,” said Mr. Fischer, an 82-year-old retired legal analyst from Lafayette, Calif., who walked away with a bagful after a visit to the Drakes Bay Oyster Co. near Inverness with his wife this week.
But trips here by aficionados like Mr. Fischer may soon come to an end. Former Interior Secretary Ken Salazar in November 2012 ordered Drakes Bay to shut down after its 40-year lease with the National Park Service ended on Nov. 30, 2012.
In so doing, Mr. Salazar cited Congress’s 1976 designation of much of the Point Reyes preserve as wilderness.
The oyster farm’s owners, Kevin Lunny and his family, have staved off closure so far by appealing the decision in the federal courts. They are now waiting to learn whether the U.S. Supreme Court will hear their case.
If the answer is yes, it would allow the Lunnys at least a few more months to continue their business, which employs 25 people and produces about a third of California-harvested oysters. The court’s decision on whether to hear the case next fall could be posted on its website Monday.
“I certainly hope things go your way,” Mr. Fischer, 82, told Mr. Lunny, who is 56-years-old.
Drakes Bay is one of several traditional businesses and activities located on the West’s vast federal lands that have come under pressure to close or reduce operations, often at the behest of environmental groups.
Mining claims have been taken over in Alaska’s Denali National Park and Preserve, while in Yellowstone National Park use of snowmobiles has been greatly restricted.
Ranchers throughout the West have had grazing leases on federal public land restricted or canceled, or ended their own private operations amid increasing regulatory pressures.
“People working and living on landscapes just doesn’t fit in their vision of what a national park should be,” said Laura Watt, associate professor and chair of environmental studies and planning at Sonoma State University, and a supporter of Mr. Lunny.
Interior Department and Justice Department officials wouldn’t comment, citing the pending litigation. But government supporters say Mr. Lunny knew the lease would expire in 2012 when he bought the oyster farm in 2004, but said he believed at the time it could be renewed.
“The government has acted fairly,” said Neal Desai, a director for the National Parks Conservation Association, an environmental nonprofit in San Francisco that supports closing the farm. “It’s only fair the contract is upheld.”
The fate of the oyster farm, which has been in operation on the site since 1934, has divided the area.
“Save Our Drakes Bay Oyster Farm” signs can be spotted throughout the community. Support extends across the San Francisco Bay Area, where Drakes Bay is a major supplier to restaurants such as Burgers & Vine in Sonoma, Calif.
Drakes Bay, which produces about 450,000 pounds of oyster meat annually with revenues of $1.5 million, is the largest of about a half-dozen oyster farms in the West Marin area.
If it closed, there likely would be no shortage of oysters because there are big producers elsewhere, such as in Washington state, to fill the gap. Oysters are also abundant on the global market, which includes Asia.
“It’s a crock, and you can quote me on that,” Carlo Cavallo, who owns Burgers & Vine, said of the ordered closure. “We are talking about a farm that has been there for almost 100 years.”
But some environmentalists and other backers of the closure say the farm, with its boats, buildings and processing activity, isn’t compatible with a wilderness area.
“Wilderness is a place where people can go to renew their spirits,” said Karen Gray, 67, owner of a bed-and-breakfast in nearby Point Reyes Station who supports the closure.
“And it provides for future generations refuge for the spirit,” she said.
The prospect of closure, meanwhile, is having a chilling effect on the farm and its employees. Paco Aceves, a crew supervisor who has worked at the farm for four years, said uncertainty about his employment has put college plans on hold for his oldest son.
“It’s hard to make plans for him,” said the 45-year-old father of three.
Amid the uncertainty, Mr. Lunny said he has reduced his staffing from 30 to 25, mostly through attrition. While he remains hopeful of ultimately winning the fight, he said it has taken a toll on him.
“The government is a powerful group to be up against,” said Mr. Lunny, who is being represented by pro bono attorneys. “They have unlimited resources and they just line up the lawyers.”
The article’s behind a paywall, but here’s the link:
http://online.wsj.com/articles/oyster-farm-digs-in-for-high-court-hearing-1403910202
Posted by Jane Gyorgy on June 27, 2014
https://oysterzone.wordpress.com/2014/06/27/06-27-14-wsj-oyster-farm-digs-in-for-high-court-hearing/
06-27-14 Marin Co Sup Court DBOC WINS OVER CCC, CCC ABUSED DISCRETION & VIOLATED the LAW
“DRAKES BAY OYSTER WAS VINDICATED TODAY
in its fight against unjust enforcement orders imposed last year
BY THE CALIFORNIA COASTAL COMMISSION.
The Marin County Superior Court
OVERTURNED THOSE ORDERS IN EVERY SIGNIFICANT EFFECT,
finding that the
COMMISSION’S
UNFAIR PROCESS
WAS AN
ABUSE OF DISCRETION
AND A
VIOLATION OF ENVIRONMENTAL LAW.”
June 27, 2014 Media Contact: Tina Walker Office: 415.227.9700 Cell: 650.248.1037 Email: tina@singersf.com
Drakes Bay Wins: Court Overturns California Coastal Commission Orders Against Oyster Farm Commission abused its discretion and violated environmental law
INVERNESS, CALIF. — Drakes Bay Oyster was vindicated today in its fight against unjust enforcement orders imposed last year by the California Coastal Commission. The Marin County Superior Court overturned those orders in every significant respect, finding that the Commission’s unfair process was an abuse of discretion and a violation of environmental law.
The enforcement orders were based on false allegations for which there was no evidence. Before a hearing last February, expert evidence disproving the allegations was provided by the Lunnys, but the Commission voted to exclude all the evidence the Lunnys presented in their own defense.
“This is a good day for California,” said Phyllis Faber, a Marin County environmental activist and biologist who was a founding member of the Commission. “The Coastal Commission had seriously abused its power. It was necessary to hold them accountable.”
Now that the Commission’s unfair enforcement orders have been overturned, the oyster farm and the Commission can get back to working on a permit for the farm.
Drakes Bay’s lawsuit against the Coastal Commission is separate from its suit against the National Park Service, which is currently pending at the U.S. Supreme Court. The Supreme Court could decide as soon as Monday whether to take Drakes Bay’s case.
About Drakes Bay Oyster Company
The historic oyster farm in Drakes Estero, located in Point Reyes, Marin County, has been part of the community for nearly 100 years. The Lunnys, a fourth-generation Point Reyes ranching family, purchased the oyster farm in 2004. Modern environmentalists and proponents of sustainable agriculture praise Drakes Bay Oyster as a superb example of how people can produce high-quality food in harmony with the environment. The farm produces approximately one third of all oysters grown in California, and employs 30 members of the community. The Lunnys also contribute the oyster shells that make possible the restoration of native oysters in San Francisco Bay and the oyster shells used to create habitat for the endangered Snowy Plover and Least Tern. As the last oyster cannery in California, Drakes Bay is the only local (and thus the only safe and affordable) source of these shells. The Lunny family is proud of its contributions to a sustainable food model that conserves and maintains the productivity of the local landscapes and the health of its inhabitants. For more information, please visit www.drakesbayoyster.comand www.savedrakesbay.com
Posted by Jane Gyorgy on June 27, 2014
https://oysterzone.wordpress.com/2014/06/27/06-27-14-marin-co-sup-court-dboc-wins-over-ccc-ccc-abused-discretion-violated-the-law/
05-19-2014 Emily Yehle, E&E reporter: Scientists Urge Supreme Court to Take Up Oyster Case
Posted by Jane Gyorgy on May 19, 2014
https://oysterzone.wordpress.com/2014/05/19/05-19-2014-emily-yehle-ee-reporter-scientists-urge-supreme-court-to-take-up-oyster-case/
05-19-2014 William Bagley, Judith Teichman et al AMICI CURIAE Brief
(Unfortunately, Adobe PDF file converter has a tendency to run words together
so I am providing access both through the link below as well as by scrolling down to read the ‘converted file.)
05-19-2014 Wllm Bagley Judith Teichman et al. AMICI CURAIE brief
No.13-1244
INTHE
SupremeCourtoftheUnitedStates
DRAKESBAYOYSTERCOMPANYandKEVINLUNNY,
Petitioners,
SALLYJEWELL,SECRETARYOFTHEUNITEDSTATESDEPARTMENTOFTHEINTERIOR,etal.,
ONPETITIONFORAWRITOFCERTIORARITOTHE
UNITEDSTATESCOURTOFAPPEALSFORTHENINTHCIRCUIT
BRIEFOFAMICICURIAEWILLIAMT.BAGLEY,ETAL.,INSUPPORTOFPETITIONERS
JUDITHL.TEICHMAN
2558Clay Street,No.1
SanFrancisco,California94115(415)309-6042
ALEXANDERD.CALHOUN
CounselofRecord
TAYLOR&COMPANYLAWOFFICES,LLP
OneFerryBuilding,Suite355SanFrancisco,California94111(415)788-8200
CounselforAmici CuriaeWilliamT.Bagley,etal.
253521
A
(800)274-3321•(800)359-6859
TABLE OFCONTENTS
- INTERESTS OF AMICI CURIAE……………… 1
- Elder EnvironmentalistsAs
- ………………………………………….. 1
- Restaurant Owners And
RestaurantsAsAmici…………………….. 2
- AgriculturalistsAnd AgriculturalSupport OrganizationsAs Amici………. 3
- Other Agricultural SupportOrganizations As Amici………………….. 4
- SUMMARY OF ARGUMENT…………………… 5
- INTRODUCTION…………………………………… 5
- FACTUAL BACKGROUND……………………… 8
- The Oyster Farm Is A SmallPresence In The Seashore’sMarine Wilderness But A LargePresence In CaliforniaAquaculture And A CriticalSource Of Fresh Shellfish For
The Bay Area………………………………… 8
i
- Survival Of The Oyster Farm IsVital To The Survival Of TheRanchesIn The Seashore AndThe Ranches In The Seashore AreAn EssentialComponentOfAgricultureIn Marin And
Sonoma Counties…………………………. 11
- Marin And Sonoma Farms AndRanchesAnd Bay AreaRestaurantsAnd ConsumersWere Leaders In The Farm-To-Table Movement And The OysterFarm Is The Bay Area’s OnlySource For Fresh, Locally-Raised
And Shucked Oysters…………………… 13
- AgricultureIn Marin AndSonoma Is Poised To LeadNational And InternationalMovements In EcologicalAnd
Sustainable Agriculture………………… 14
- TREATING THE LACK OF A PERMITTO OPERATE IN DRAKES ESTEROAS THE “EXISTING CONDITION”FOR NEPA REVIEW AND ASSUMINGTHAT REMOVING DBOCWOULDBENEFITTHE ENVIRONMENTIS
- ……………………………………………. 19
- APPLICABLE FEDERAL, STATE ANDLOCAL LAWS AND POLICIES INSUPPORTOF AQUACULTURE ANDAGRICULTURE HAVE YET TOBE
- ……………………………………. 22
ii
- Coastal Zone Management ActAnd CaliforniaCoastal ZonePolicies RequireFederal AgenciesTo Support AquacultureIn
Federal Activities…………………………. 22
- The National Aquaculture Act Of1980 Obligates The Secretary To
Support Aquaculture……………………. 24
- SUMMARY………………………………………….. 25
- CONCLUSION…………………………………….. 27
iii
TABLE OFAUTHORITIES
STATUTESAND AUTHORITIES
16 U.S.C.§1456(c)(1)……………………………………………
16 U.S.C. § 2801 § 2(b)…………………………………………..
16 U.S.C. § 2801§2(c)…………………………………………..
16 U.S.C.§2802(7)……………………………………………….
16 U.S.C.§2805(d)……………………………………………….
40 C.F.R. § 1505.2…………………………………………………
40 C.F.R. § 1506.1…………………………………………………
40 C.F.R. § 1506.10……………………………………………….
42 U.S.C.§4221(a)……………………………………………….
- Const. art. IV, §20…………………………………………
- Public ResourcesCode, § 30100.2…………………….
- Public ResourcesCode, § 30242……………………….
2006 NPS Management Policies, § 4.1…………………….AgritourisminMarin,”ontheUCCE,“Grownin
Marin” website: http://ucanr.edu/sites/ Grown_in_Marin/files/152641.pdf,andwww.foodandfarmtours.com………………………………………
Brett Anderson, “The New Wave of OysterBars,”NY Times,May 6, 2014……………………………
iv
EdwardWong,“One-FifthofChina’sFarmlandIsPolluted,StateStudyFinds,”NYTimes,
April17,2014………………………………………………….
Gale,Sally,“EnvironmentalEffectsbyRanchersandtheMarinRCDinMarinCounty,”MRCD,Apr.11,2014,availableathttp://www.marinrcd.org/wp/reference-
library…………………………………………………………….
Goldstein, J., Inside the California FoodRevolution:ThirtyYearsThatChangedOurCulinaryConsciousness,Univ.ofCal.Press(2013)……………………………………………………………..
Kehoe and McClure families on the CloverStornettawebsite:http://cloverstornetta.com/
our-story/family-farms-2…………………………………..
NPS Director’s Order 12: 3.4.A.3 CategoricalExclusions. http://www.nps.gov/policy/catexguidance.pdf…………………………………………………….
U.C.C.E. “Amazing But True: Facts AboutMarinCountyAgriculture.” Availableonline
at http://cemarin.ucanr.edu/files/30457.pdf………..
v
I. INTERESTSOFAMICI CURIAE1
- ElderEnvironmentalistsAsAmici.
WilliamT.Bagley:asaCalifornia Assemblyman(1961-1974)Bagleyauthored1965legislationtransferringthePointReyestidelandstotheNationalParkService[NPS],specificallyreservingtheState’s“righttofish.”Bagleyservesasanamicusbecause“theyshouldn’ttrytoreinterpretthe law while the author is stillliving.”
PaulNorton“Pete”McCloskey:AsamemberofCongress(1967-1983),McCloskeyco-authoredtheEndangeredSpeciesActandintervenedwiththe OfficeofthePresidenttosecurethe1970CongressionalappropriationthatenabledtheNPStoacquirein1972thelandandfacilitiesonshore DrakesEsteroownedbythepredecessortotheDrakesBayOysterCompany[DBOC].Hiscontinuingcommitmentandinterestin preservingaquacultureandagricultureinthePointReyesNationalSeashore[Seashore]wasdemonstratedinaBagley,[formerCongressmanJohn]Burton,McCloskeyAugust2011 letter tothen U.S.Department of the Interior [DOI] Secretary
1Pursuanttothis Court’sRule37.3, all parties have consentedto the filingof this brief.Letters evidencing suchconsent arebeing submitted to Clerkof the Courtherewith.Pursuant toRule 37.6, Amici Curiae affirm that no counselforany partyauthored this brief in whole or in part, andno counsel or partymade a monetary contribution intended to fund the preparationor submission of this brief.No personother thanAmici Curiae,their members, ortheir counsel made a monetarycontributionto its preparation or submission.
1
KenSalazar.2
PhyllisFaber:anotedwetlandecologist,was aco-founderoftheMarinAgriculturalLandTrust[MALT],whichhasprotectedalmost50%ofMarin’sagriculturallandthroughtheuseofconservationeasements.BecauseofhercommitmenttosavingagricultureinMarin,Faberisonleavefromthe MALTBoardtodevotemoretimetotheeffortofsavingDBOC.
TomalesBayAssociation:DBOC’s cannery,theonlyremainingoystercanneryinCalifornia,istheonlysourceforshuckedoystersandtheshellsDBOChasdonatedtonativeoysterrestorationprojectsandwildlifehabitatenhancementprojectsinandaroundSanFranciscoBay.A50-yearoldWestMarinCountyenvironmentalorganizationattheforefrontofmanyenvironmentalissuesthroughtheyears,TomalesBayAssociationsupportsDBOCas“acriticalcomponentofon-goinghabitatrestorationprojectsforThreatened&Endangeredspecies,especiallynativeoysterrestorationprojectsinSFBay and elsewhere in the State.”
B. Restaurant Owners AndRestaurantsAsAmici.
Thefollowingserveasamicitoemphasizethe importanceofDBOCshellfishtothemenusofthe myriadBayArearestaurantsofallsizesthatfeaturefresh, local and sustainably raised food:
2NinthCircuitDocketNo.74,atECFp.137of143.
2
- PatriciaUnterman,bothindividuallyanddbatheHayesStreetGrill,aSanFranciscoCivicCenterrestaurantthathasspecializedinfishsince opening in 1979;
- SherylCahill,individuallyanddbaStationHouseCafe,PointReyesStation,celebratingits40thanniversary,whereoysterstewisasignaturedish;
- ChristianCaizzo,individuallyanddbaOsteriaStellina,PointReyesStation,anItalian restaurant“withanunwaveringcommitmenttolocalorganicproducts”servesDBOCoysters raw and on pizza; and
- LucChamberland, individuallyanddba SaltwaterOysterDepot,Inverness,featuresoystersshucked“momentsaftertheyleavethebay.”
C. AgriculturalistsAndAgricultural Support Organizations As Amici.
The interests of the following are describedmore fully in the brief:
- StephanieLarson:LivestockandRangeManagerandDirectoroftheUniversityofCaliforniaCooperative Extension [UCCE], Sonoma County.
- PaulOlin:AquacultureSpecialistforCaliforniaSeaGrant,ScrippsInstitutionofOceanography[SIO],UCSanDiego[UCSD].TheSeaGrant programpromotesthewiseuseofcoastalandmarineresources and sustainable aquaculturedevelopment.
3
MikeandSallyGale:OwnersofMarinranchwherethey raise apples and grass fed beef.
Peter Martinelli: Third generation Marin farmer.
WestMarinCompostCoalition[WMCC]:AgroupofindividualsworkingtodivertallorganicwastesfromlandfilldisposaltocompostingforthebenefitofMarin farms, gardens and ranches.
D. OtherAgriculturalSupport Organizations As Amici.
Agricultural Institute ofMarin[AIM]:DBOConlysellsitsproductlocally,toretailers,restaurantsandconsumers.AIMisanonprofitcorporationthatoperates“CertifiedFarmers’Markets”inMarin, AlamedaandSanFrancisco.Itjoinsasanamicusbecauseofitscommitmenttosupportingenvironmentally soundlocalagriculture.
AllianceforLocalSustainableAgriculture[ALSA]:Anunincorporatedassociationof“environmentalistssupportingandpromotinglocalsustainableagriculturethrougheducation,research,conflictresolution and advocacy.”
CaliforniaFarmBureauFederationandMarinandSonomaCountyFarmBureaus:Theseamiciarenonprofitmembershipcorporationswhosepurposeis,respectively,toprotectandpromoteagriculturalinterestsintheStateandintheirCountiesandtofindsolutionstotheproblemsoftheirfarmsandrural communities.
MarinOrganic:Foundedin2001by“apassionategroupoffarmers,ranchersandagriculturaladvisorstoput MarinCounty onthe mapasacommitted
4
organiccounty,”MarinOrganicfostersa“directrelationshipbetweenorganicproducers,restaurants,andconsumers”tostrengthencommitmentandsupportfor local organic farms, such as DBOC.
II. SUMMARYOFARGUMENT
Thisbriefsetsoutthefactsthatestablishtheimportanceofthiscasetoaquacultureand agricultureintheSanFranciscoNorthBayandtorelatedbusinessesandtothedevelopmentofinnovative,ecologicallysoundandsustainableagriculturepracticesconsistentwiththepurposesofthe National Environmental Policy Act [NEPA].
III. INTRODUCTION
TheNinthCircuitheldthatremovingcultivatedoystersfromDrakesEsteroconstitutesa “conservation”effort,andthattheDOISecretaryofSecretaryisnotobligatedtocomplywiththe“technical”environmental review requirementsof theNEPApriortoorderingPetitionerDBOCtoceasecultivatingoysters in Drakes Estero.3
ThiscaseprovidestheCourtwithaclearcut opportunitytoclarifytheenvironmentalreviewrequirementsofNEPA,andintheprocess,bringNinthCircuitCourtdecisionsonNEPAintolinewithdecisionsinothercircuits4andmovetheDOIlandmanagement practices intocompliance withcontemporary environmental protection standards.
3Pet.App., pp.31-33 (Jan. 14, 2014 Order and AmendedOpinion).
4SeePet. Brief, p.27, et seq.
5
ThemostsuccinctandpertinentstatementoncontemporaryenvironmentalthinkingappearsonThe Nature Conservancywebsite:
“Isthereanywildleft?‘No,’saysourchiefscientist–‘whichmeanswehavetomanagenaturewisely.’”5[Emphasisadded.]
Oystersprovide multiple ecosystemservices,consumingalgae,filteringparticulatesandexcessnutrientsandcreatinghabitatforotherorganisms. Bythe1930s,thenativeOlympiaoystersthatperformedtheseecologicalservicesinDrakesEsteroformillenniawerenearlyextirpatedbyoverharvesting.CultureofthePacificoysterbeganin1932,andtheStateofCaliforniahasleasedthewaterbottomsinDrakesEsteroforshellfish cultivation,including cultivationof the Pacific oyster,continuouslysince1934.6“Managingnaturewisely”doesnotincluderemovingthecultivatedoystersthatreplacedthenativeoystersthatperformedecosystemserviceswithoutidentifyingalternativeresourcesforprovidingthoseservices,ifanytherebe. EvenNPS
5Seethe report onan article, “Domesticated Nature: ShapingLandscapes and Ecosystems for Human Welfare,” by TheNature Conservancy’s Chief ScientistPeter Kareiva, and SeanWatts, Robert McDonald, and Tim Boucher.Science, June2007, Vol. 316, no. 5833, pp.1866-69.In the accompanyinginterview publishedonline, Dr. Kareiva was asked ifitis“misleading to think about nature as apart from humanactivity.”Kareiva said, “it is a huge mistake … anytime we[humans] have the hubristo thinkwecan separate ourselvesfrom nature,we are prone to some profoundfoolishness.”http://www.nature.org/science-in-action/our-scientists/the-end-of-the-wild.xml.
6Summary,National Academyof Sciences, National ResourceStudy.
6
policiesrecognizethatsimplyremovingaman-madeconditiondoesnotautomaticallyrestoreresourcesthat have been impacted by humans:
Biologicalorphysicalprocessesalteredinthepastbyhumanactivitiesmayneedtobeactivelymanagedtorestorethem to . . . maintain the closestapproximationofthenaturalconditionwhenatrulynaturalsystemisnolongerattainable.[Emphasis added.]7
ThisbriefopenswithadescriptionoftheimportanceofDBOCtoaquaculture,agriculture,andthefarm-to-tablemovementlocallyandbeyond,and,becauseoftherippleeffect,tothedevelopmentofinnovative,ecologicallysoundandsustainableagriculturalpracticesinCalifornia,nationally andinternationally;agricultureconsistentwiththepurposesofNEPA,thatis,“toencourageproductiveandenjoyableharmonybetweenmanandhisenvironment.”8
FollowingamorefulldiscussionoftheNEPAissue,thisbriefidentifiesfederal,stateandlocal laws,policiesandothermandatespertainingtocoastalzonemanagementandsupportforaquacultureandagriculturethattheSecretaryfailedtoconsiderinmakinghisdecisiontodenyDBOCapermit.
7Excerptfrom 2006NPS ManagementPolicies, § 4.1: GeneralManagementConcepts. www.nps.gov/policy/mp2006.pdf
842 U.S.C.§ 4221(a).
7
IV. FACTUAL BACKGROUND
- The Oyster Farm IsASmallPresenceIn The Seashore’sMarineWildernessButA Large PresenceInCaliforniaAquacultureAndA CriticalSource Of Fresh ShellfishFor TheBayArea.
OccupyinglessthanfiveacresontheshoresofDrakesEstero,DBOCisanegligiblepresenceintheSeashore’s38,000acrepastoralzone.The142acresusedtocultivateshellfishintheDrakesEstero tidewaterspursuanttoleasesauthorizedbytheconstitutionally-establishedCaliforniaFishandGameCommission[CFGC]9arelessthan.6%oftheSeashore’s2,500acremarinewilderness,10but55%oftheCFGCleasedshellfishacreage.Nevertheless,during2009-2011DBOCproducedalmost50%ofthePacificoystersraisedinCaliforniaandalmost70%of
9Cal.Const. art. IV, § 20.
10“FEIS”pp.10 & 13. Whatis referred to inthe Ninth Circuitdecision as the “Final Environmental Impact Statement” was“issued” by the Department of the Interior [DOI] onNovember20, 2012, nine days(including Thanksgiving Day)before theSecretary announced his decision on the DBOC request toreplace the permit that expired on November30, 2012.
Environmental ProtectionAgency [EPA] regulations requirefederal agencies to issuea “record of decision” a minimum of 30days beforean agency takes any actionthat would “have anadverseenvironmental impact” or “limit the choice ofreasonable alternatives.”Each weekEPA publishes a FederalRegister notice of the statementsfiled during the precedingweek. There isno recordof a noticefiledfor what DOIrefers toasthe “FEIS,” hence thequotation marks. See40C.F.R.
§§ 1505.2, 1506.1 and 1506.10.
8
thePacificoystersraisedinMarin.11Thus,althoughasmallpresenceintheSeashore’stidalzone,DBOCisalargepresenceinCaliforniaaquacultureandanirreplaceablesourceoffreshshellfishforBayArea restaurants.
OystersandothershellfishfromDrakesEsteroareanimportantpartoftheBayArea’sworldfamouslocal,sustainablyraisedfoodmovement.AccordingtoJoyceGoldstein,chefandcookbookauthor,oysters have long been:
…apopularNorthernCaliforniaspecialty. TheOlympiaoysterflourishedintheSanFranciscoBayandwasastapleinthedaysoftheforty-niners.HangtownFry,acombinationof oysters,baconandeggs,hasreputedlybeenonthemenuatSanFrancisco’sTadichGrillforover160years.OysterfarminginCaliforniadatesbacktothe1850s,andinthe1890soysterculturewaspracticedinTomalesBayandDrake’s Bay in Marin County . . . .
TheBayAreastillharborsa passionforoyster,andtheyarefeaturedonthemenuatmanySanFranciscorestaurants. 12
11“FEIS” p.279.Oystersare sometimes described byweight,volume or number. Only small amounts of other varieties ofoysters are raised in California.
12See Goldstein, J., Inside the CaliforniaFoodRevolution:ThirtyYears That Changed OurCulinary Consciousness, Univ.ofCal. Press(2013), a historyof the farm-to-table movement inCalifornia, and howit has raised the consciousnessabout whatis eaten throughout the United States and the world, at pp.236-
- The history begins inthe mid-1970s with the origins of
9
ProducersinCaliforniaandaroundthecountryareunabletomeetthegrowingdemandforshellfish.13OnbehalfoftheHayesStreetGrill,andthemanyBayArearestaurants,includingotheramici, amicus Patricia Unterman confirms:
ThelossofoystersproducedbyDBOC wouldhaveadevastatingimpactonourmission,ourmenu,andtheexpectationsandpleasureofourcustomers.Wecannotreplacethefresh,localshuckedoysters from DBOC.14
IncommentsontheDraftEnvironmentalImpactStatement[DEIS],theotherMarinshellfishproducers,theTomalesBayOysterCompanyandHogIsland,urgedthatDBOCbegrantedthepermit. Amongothergrounds,theysaidtheycouldn’tmeetthelocaldemandforfreshoystersandthatclosingDBOC would harm them and their customers.15
“California cuisine,” featuringfresh seasonal ingredientscombinedinways that reflect the ethnic and cultural diversityinthe State.A NorthernCalifornia “clienteleeagerfor foodrather than froufrou”is among the factors cited asresponsiblefor the virtually overnight emergenceof this new style of foodpreparationanddelivery.
13“FEIS”p.274.See also,“The New Wave of OysterBars,” byBrett Anderson, NY Times, May 6, 2014.
14Patricia Unterman is recognized in Goldstein’shistoryofCalifornia cuisine as oneof the Bay Area women chefs who“hired, mentored, and promoted otherwomen.” p.90.
15DEISComments 50395 and 52047.TheDOI response in the“FEIS”? “[I]fthe demand … is greatenough … it is likely thatthe marketwould adapt.. ..” “FEIS”p.480.
10
B. SurvivalOf The Oyster Farm IsVital To The SurvivalOf TheRanches In The Seashore And TheRanchesIn The SeashoreAreAnEssentialComponent OfAgricultureInMarinAndSonoma Counties.
AbouthalfofMarinCounty,roughly167,000acres,isproductiveagriculturalland.AccordingtotheUniversityofCaliforniaCooperativeExtension[UCCE]Service,thereare255agriculturaloperationsinMarin,ofwhichonly64haveanannualgrossincomeinexcessof$100,000.TheaveragesizeofaMarinfarmis588acres.Over70%ofMarin’sfarmsareoperatedbyathird,fourthorfifthgenerationmemberofthefoundingfamily.16Farmoperatorsareengagedinagriculturebecause theylovethelandandtheopportunitytoworkasafamily andpartofthecommunity,notforwealth.Theyappreciatewildlifeandfeelprivilegedtobestewardsof their land for the years it is in their care.17
16U.C.C.E. “AmazingButTrue:Facts AboutMarinCountyAgriculture.”Available online athttp://cemarin.ucanr.edu/files/30457.pdf.
17For example, amici Sallyand Mike Galedemonstrate theircommitment through “green award” winning streamconservationworkon their Marin ranch and to preserving theiragriculturalheritage andtheir community through theirvolunteer work.Afourthgeneration rancher andmemberof the MarinCounty Resource Conservation District[RCD] Boardforover 15 years, Sally Gale uses a slide presentation in talksshe gives about RCD’s work that reflects Marin’s very special“farm-culture.” Gale,Sally, “Environmental Effectsby Ranchersand the Marin RCD in Marin County,” MRCD, Apr. 11, 2014,available athttp://www.marinrcd.org/wp/reference-library.
11
TherearesixcattleranchesintheDrakesEsterowatershed.18Althoughnotscientificallyverified,NPSconsiderscattlewastefromtheseranches“theprimarysourceofnonpoint-sourcepollution”in the watershed:
…Specifically,fecalcoliformlevelsin mostofDrakesEsterohavebeenshowntointermittentlyriseafterraineventsassociatedwithrunofffrompasturesinthewatershed[citationomitted].Inadditionotherpollutionsourcesincluderesidentialsepticfacilitiesassociatedwithranchingoperations….Continuedranchinginthevicinityoftheprojectareahasthepotentialtoimpactthefollowingresources:waterquality and socioeconomic resources.19
AmicusDr.StephanieLarson,Livestockand RangeManagerandDirectoroftheUCCE,SonomaCounty,developsandimplementsprojectsthatintegratedairyandlivestockproductionwithrangelandmanagementinSonomaandMarin.ShehasextensiveexperienceworkingwithSeashore rancherstodevelopindividual ranchplans,which addresswaterqualityissuesintheDrakesEsterowatershed.Dr.Larsonisconcernedthatdespite theseeffortstheranchesintheDrakesEsterowatershedmaybeheldresponsiblefordecliningwaterqualityintheEsteroandrequiredtotake additionalcostprohibitivemeasuresifthefilterfeedingoystersareremovedfromDrakesEstero. Dr.
18Unless otherwise specified, “ranches”includes dairiesas wellas grazing operations.
19“FEIS”p.303.
12
Larsonwarnsofadominoeffectfromtheloss of theseranchesthatwouldcausetherestoftheSeashoreranchesandlivestockagriculturethroughoutMarin and Sonoma Counties to fail.
Almost20%ofMarin’sagriculturalproductscomefromranchesintheSeashore’spastoralzone.Ranches inMarinareremotefromthesourcesofagriculturalservices.TheremustbeactiveranchesintheSeashoretomaintainsufficientdemandfor agriculturalsupplierstoprovideneededservicesinthe rest of Marin and in Sonoma County.
C. Marin And Sonoma Farms AndRanchesAndBayAreaRestaurants AndConsumersWere Leaders InThe Farm-To-Table Movement AndTheOysterFarmIsTheBayArea’s OnlySource For Fresh, Locally-RaisedAnd Shucked Oysters.
MarinandSonomaCountyfarmsandSanFranciscoBayArearestaurantsandconsumerswereamongtheearlyleadersinwhatisrecognizedeveninfederalfarmlegislationasthe“farm-to-table”movement.Itisamovementawayfromtheuseofprocessedfoodsforahealthierpopulationandahealthierenvironment.20
WhenthefoodrevolutionbeganinMarinand Sonomacountiesinthe1970s,thenation’sfoodsystemhadgrowntoanindustrialscale.Therewaslimitedvarietyinthefoodsupply,andtheenvironmentalimpactofchemicallyandmechanically intensive food production was a
20See Goldstein’s book, Inside the CaliforniaFoodRevolution,supra.
13
growingconcern.TherecentlyreportedpoisoningofarablelandinChinaisanunfortunateanddramaticexampleoftheconsequencesofpoorlymanagedagriculture.21
Asdescribedabove,DBOCraisesalmost70%ofMarin’soystersandsellsallofthemintheSanFranciscoBayArea.Astheoperatorofthe lastoystercanneryinCalifornia,DBOCistheBayArea’sonlysourceforthefresh,locallyraisedandshuckedoystersusedinmanyrecipes and menu items.DBOCisacriticalelementinthehealthofthefarm-to-tablemovementforwhichtheBayAreafoodshedisfamous.
D. AgricultureInMarinAndSonoma Is Poised To Lead National AndInternationalMovementsIn EcologicalAnd SustainableAgriculture.
SanFrancisco’sNorthBayagriculturalcommunitiesareleadersinvaluingbothproductiveagriculturallandandtheroleitplaysinhabitatprotection.MarinCountyfoodproducers,includingDBOCandtheirpartneringfarmadvisors,areleadersinthepracticeofecologicalfarming.Theirworkishelpingtotransformhowagricultureispracticedthroughouttheworld,justastheirinvolvementinthefarm-to-tablemovementledtoarevolutionineatingthatisreducingsuchdiseasesaschildhoodobesity.
21“One-Fifth of China’s Farmland Is Polluted,State StudyFinds,” Edward Wong, NY Times, April 17, 2014.As reported,the main agricultural sources are “irrigationof land by pollutedwater, the improper useof fertilizersand pesticides, andlivestock breeding … .”
14
InASandCountyAlmanac,thereveredecologistAldoLeopold“calledforanethicalrelationshipbetweenpeopleandthelandtheyownandmanage,whichhecalled‘anevolutionarypossibilityandanecologicalnecessity.’”22Bywayofexample,twoMarindairieshavebeenrecognizednationally for their “ethical relationship” to the land.
TheStrausfamilydairystoppedusingherbicidesinthemid-1970s.Intheearly1980sitstoppedusingchemicalfertilizersandadoptedano-tillmethodofplantingtopreventsoilerosionandreducefuelconsumption.Inthe1990sStrausbecamethefirstcertifiedorganicdairywestoftheMississippi,installedoneofthefirstmethanedigestersinMarinCounty,andopenedthefirst 100%certifiedorganiccreameryintheUnitedStates.23In1998,theAmericanFarmlandTrusthonoreddairymatriarchEllenStrauswithits“stewardoftheland”awardforhereffortsinlandstewardship,farmlandconservationandpioneeringofenvironmentallyandeconomicallysustainablefarmingpractices.”24
InDecember2013,theSandCountyFoundationgaveits“LeopoldAward”totheownersofPointReyesFarmsteadCheeseCompany,BobGiacomini andhisfourdaughters.Theawardhonors“privatelandownerachievementinthevoluntarystewardshipandmanagementofnaturalresources.”
22See the Leopold ConservationAwardwebsite:leopoldconservationaward.org.
23Seewww.farmland.org/programs/campaign/documents/14-StrausFamilyCreamery.pdf.
24www.farmland.org/programs/award/Winners-1998.asp.
15
TheLeopoldAwardisconsideredtheNobelPrizeforagriculture.
Second,thirdandfourthgenerationsbring historyandauniqueunderstandingtotheland.Thisisillustratedbythedifferentperspectivesina reportaboutthevoluntaryPineGulchCreekrestorationproject.Accordingtoanurban environmentalist:
Undertheplan,aviable populationofcohowilleventuallybere-establishedinPineGulchCreek.Theprojectdemonstratesthatwithknowledgeableandcaring landstewardsandcommunitysupport,coho salmonandsteelheadtrouthabitatscanberestoredandco-existwithsustainable agriculture.
Thirdgenerationfarmer,amicusPeterMartinellisaid:
Whilethebasicfacts[inthe report]areaccurateandthemessageis generallypositive,Ihavetroublewiththeimpliedmessagethatsomehowthe fishpopulationwillrebound,butwithouttheproject,thefarmer’spumpinghasbeenthecauseoflowfishpopulations….Manyfactorshavecontributedtothefishdeclines….We mustalsoconsiderchangingocean conditions,theheavysiltationofBolinasLagoonoverthedecades,theconditionoftheripariancanopy,and thegrowthofahungrysealandsealioncolonyalongthechannelwherespawning fish hold for weeks and
16
sometimesmonthsbeforerunningupstream.25
Asanotherexampleofthisunique community’scontributiontoecologicallysoundagriculture,inthequestofMarinfarmersandrancherstobettercareforthelandandenvironment, amicusWMCC,26workingwithUniversityofCaliforniascientists,discoveredthatcompostappliedtoCalifornia’sgrasslandscancatalyzecarbondioxideremovalfromtheatmosphereandputittobeneficialuseassoilorganicmatter,thusincreasingthesoil’sfertilityandretentionofwater.AsaresultofjustoneapplicationofcomposttoseveralsmallresearchplotsinMarinandintheSierraNevadafoothills,thesoilineachplotsequesteredover2,000poundsofcarbonasbeneficialsoilcarbonandretaineduptoanadditional16,000 liters of water:
Thisresultfromthatoneapplicationofcomposthasbeenrepeatedineachofsixyears,andsimilarresultsareprojected tocontinueforatleastanother25years.27
25MarinConservation League [MCL] Sept/OctNewsletter, pp.6-
- Also, for asnapshot of two proud multiple generation dairyoperators inthe Seashore, seethe Kehoe and McClure familieson the Clover Stornettawebsite: http://cloverstornetta.com/our-story/family-farms-2.
26Thereisoverlap in membership of some amicimost active inpromoting ecologically sound agriculture.E.g. petitioner KevinLunny and agroecologist Dr. Jeffrey Creque are members of theWMCC.Creque is also amemberof amicus ALSA.
27See announcementin the May/JuneMCLNewsletter, p.5:www.conservationleague.org/images/stories/Newsletters/nl14c_mayjun2014_forweb.pdf
17
IfameansforfinancingthepurchaseandspreadingofcompostongrasslandsthroughoutMarinandCaliforniacanbefound,suchasthesaleofcarbon credits,organicwastecouldbecomeameansbywhichtheStateandNationcouldbegintooffsettoday’sdangerouslevelsofcarbonemissionsandthe impacts of drought conditions.
InthepastfortyyearsWestMarinhasbecomeinternationallyrecognizedasaleaderinenvironmentallysoundfood production.ThisreputationledEngland’sPrinceCharles,alongtimeadvocateand food producerinthesustainablefoodmovement,totourWestMarinfarms,includingDBOC,inNovemberof2005.Inthewakeofdecliningtobaccosubsidiesin2007notedagrarianauthorWendellBarrysoughtexamplesoffoodproducersabletothriveeconomicallywhilecaringfortheenvironment.BarryinvitedacontingentofWestMarinfoodproducers,includingamicusPeterMartinelli,to a symposium, “GrowingKentucky”.28
IfDBOCisclosedandthedominoeffect rendersagricultureinMarinandSonomalessviable,inevitablytheeffortsthatledtosuccessesofthecarbonprojectandotherecologicallypromisingagriculturalpracticeswithrootsinMarinwilldiminish.Agricultureand the environment inCalifornia,thenation,andinternationallywillbediminishedas a consequence.
28See also, “Agritourism inMarin,”on theUCCE, “Grown inMarin” website:http://ucanr.edu/sites/Grown_in_Marin/files/152641.pdf,andwww.foodandfarmtours.com.
18
V. TREATING THE LACK OFAPERMIT TOOPERATE INDRAKESESTEROAS THE“EXISTING CONDITION” FORNEPAREVIEWANDASSUMINGTHAT REMOVING DBOCWOULD BENEFITTHEENVIRONMENTISABSURD.
Oysterproductionrequiresnoexternalinputoffeed,fertilizers,chemicalsorfreshwaterwhileconsumingalgae,filteringparticulatesandexcessnutrientsandcreatinghabitatforotherorganisms. Amazingly,oneoystercanfiltermorethan50gallonsofwaterin24hours.CultivatedpursuanttoCFGCleases,thePacificoysterhasperformedtheseecologicalservicesinDrakesEsterocontinuouslysince1934.29
OnNovember29,2012,withoutexaminingtheecologicalconsequencesofremovingthecultivatedoystersfromDrakesEstero,orconsultationwiththeCFGC,theSecretaryorderedtheState’slessee, DBOC,toceasecultivatingoystersinDrakesEsteroandtoremovetheexisting20millionoysters,othershellfish,andlongestablishedoysterracksandcultivationmaterialswithin90days.TheSecretaryasserted,contrarytoscientificevidenceandfindings,thateliminatingDBOC“wouldresultinlong-termbeneficialimpactstotheestero’snaturalenvironment.”30TheSecretarydidnotconsiderthepredictableadverseconsequencesthatwouldresultfrom his order.
29Summary, National Academyof Sciences,National ResourceStudy.
30See Pet. App., p.26. Cf. widespreadeffortsto restoreoysterbeds, including inSan Francisco Bay, NewYork Harbor,Chesapeake Bay and the Gulf ofMexico.
19
TheNinthCircuitpanelfoundithadjurisdictionovertheNEPAclaim.Dismissingwhatitcaptioned“technicaldeficiencies”intheNEPAprocessas“withoutconsequence,”31theNinthCircuitupheldtheactiononthegroundsthat“[t]heSecretary’sdecisionisessentiallyanenvironmentalconservationeffort,whichhasnottriggeredNEPAinthepast,”andthat“removingtheoysterfarmisasteptowardrestoringthe‘naturaluntouchedphysicalenvironment.’”32Indiscussingthelikelihoodofsuccessonthemerits,themajorityupheldtheSecretary’sdecisionbecausehe“chosetogiveweightto the policies underlying wildernesslegislation . .. .” 33
AuthorsoftheDEISand“FEIS”declinedtotreattheexistingtidalwaterswiththeir80-year-old existingoysterfarmasabaselineandtoexaminethe impactontheecosystemofremovingoystersandtheirecologicalservicesfromDrakesEstero.Rather,theDOIusedtheabsenceofaNPSpermit,apieceofpaperwithwritingonit,asthebaseline“existingcondition”forpurposesofNEPAreviewofbothuseoftheonshorefacilitiesownedbytheUnitedStatesandforcontinuedcultivationofoystersintheDrakes EsterotidalzonepursuanttoleasesauthorizedbytheCFGC.34 NEPArequiresanexaminationofthe
31Seefootnote10,supra.
32Pet. App.,pp.31-33.
33Pet. App.,pp.24-25.
34Ina bizarre example of “heads Iwin, tailsyoulose,” the“FEIS” provides that DBOC would be required to “surrender itsstate water bottom lease to theCFGC prior to issuance of a newSUP by NPS.”“FEIS” p.9.Immediately followinga descriptionofa State plan that identifies Drakes Estero as “astate marineconservationarea where takeof all living marine resourcesis
20
impactonthephysicalenvironmentofalternativecoursesofaction,notareviewofpoliciesabstractedfrom the consequencesof their application.
RelianceonacontemporaneousdecisionnottorenewtheDBOCleaseasthe“existingcondition,”thebaselineforpurposesofNEPAreview,defiescommonsense.TheNinthCircuitmajority’sassumptionthatremovingDBOCwouldnecessarilybenefittheenvironmentistheantithesisofwhatCongressintendedinadoptingtheNEPA.ItwouldreduceNEPAreviewtoaproceduralnicety,atmost.Iflefttostand,theNinthCircuitdecisionthatthedenialofapermitunderthesecircumstancesdoesn’trequireenvironmentalreviewwillserveasprecedentforandencouragetheNPStoidentifyasham“existingcondition”forthepurposeofenvironmentalreview whenever itsuits its purposes.35
prohibited, except for …commercial aquaculture of shellfishpursuant to avalid statewater bottom lease andpermit,” the“FEIS”, p.63,states: “Section 124 …does not relieve DBOCofits obligationto comply with the California Marine LifeProtection Act.”
35Note: thereis both authority and precedentfor granting theOysterFarma permit without additional environmental review.The indefinite continuation of the Oyster Farm andthe ranchesinthe pastoral zone was contemplated inthe 1980GeneralManagementPlan [1980GMP]for the Seashore, which remainsin effect following the NPS’s failure to follow through onaneffort to update it that began in 1999.Permitsforthe ranchesinthe Seashore’s pastoral zone are routinely reissuedorrenewed without additional environmental review on theground that the grantingofa permit simply allowsan existinguse,which has already been subject toenvironmental review, tocontinue unchanged.SeeNPS Director’s Order 12:3.4.A.3CategoricalExclusions.http://www.nps.gov/policy/catexguidance.pdf.
21
ThePetitionforaWritofCertiorarifullydiscussestheconflictintheCircuitCourtsover“whetherNEPAappliesto‘conservationefforts,’”pages27-32.Thatdiscussionwillnotberepeatedhere.
VI. APPLICABLEFEDERAL, STATEANDLOCAL LAWS ANDPOLICIESINSUPPORTOF AQUACULTURE ANDAGRICULTUREHAVE YET TO BECONSIDERED.
- Coastal Zone Management ActAndCaliforniaCoastal Zone PoliciesRequireFederal Agencies ToSupport AquacultureIn FederalActivities.
The1972CoastalZoneManagementAct[CZMA]requiresfederalagenciestodefertoStatepoliciesonmanagementinStatecoastalzoneswhenever“practicable.”36TheCalifornia coastalzonemanagementplandefinesaquacultureas“agriculture,”37andtheenforceablepoliciesoftheplan providethat:
…landssuitableforagriculturaluse shallnotbeconvertedtononagriculturalusesunlesscontinuedorrenewedagriculturaluseisnotfeasible. 38
Inaddition,underStatelaw,localjurisdictions adopt “local coastal plans.” The
3616 U.S.C.§1456(c)(1).
37Cal. PublicResources Code,§30100.2.
38Cal. PublicResources Code,§ 30242.
22
Secretary’sdecisionignoredtheMarinCountyCommunityDevelopmentAgencycommentsadvisingthattheDBOCrequestforapermit“forcommercialharvestingandprocessingofshellfishisconsistentwithCountyagriculturalandmariculturepoliciessetforthin the Marin County Local CoastalProgram .. . .”RelevantexcerptsfromtheLCP,includingaparagraphspecificallyreferringtotheOyster Farm by its former name, followed:
TheCoastalActstronglysupportsthepreservationofagriculturallandsinproductiveagriculturaluseandstrictly controlstheconversionofagriculturallands to other uses . . . .
Maricultureoperationsinthe areaofthefederalparksconsistofthe 1060-acreJohnson’sOysterFarminDrake’sEstero….Johnson’sOysterFarmisamajoroysterproducerstatewideproducingsome20%ofthestate’s total marketable oystercrop. 39
The“FEIS”andtheSecretary’sdecisiondisregardanOctober10,2012,letterfromtheDirectoroftheCaliforniaDepartmentofFishandGame40pointing outthat:
Thestateandfederalgovernmenthaveworkedtogetherfor47years–sincetheStateoriginallyconveyedthe bottomlandsinDrakes Esterotothe United States in 1965 – to allow
39Comments on DEIS, Correspondence #4106.
40Ninth Circuit Docket 80-1at p.91.
23
continuedaquacultureoperationsinDrakes Estero. Correspondencebetweenouragenciesshortlyafterthe conveyancestronglysuggeststhatouragenciesthenbelievedthattheState’sreservationoffishingrightsincludedtherighttoleasethebottomlandsatDrakesEsteroindefinitelyforshellfishcultivation.
* * * * * * *
Thecontinuedcooperation betweenDrakesBayOysterCompany,theNationalParkServiceandthe CaliforniaDepartmentofFishandGamewillbenefittheenvironment,thecommunity,andthelocaleconomy,consistentwithouragencies’uniquehistoryofmanagingthisproperty….
B. The National Aquaculture Act Of1980 Obligates The Secretary ToSupportAquaculture.
IncommentsontheDEIS,the NationalMarineFisheriesService[NMFS]oftheNationalOceanicandAtmosphericAdministration,U.S. DepartmentofCommerce,recommendedthattheNPS“improvetheoveralltechnicalqualityoftheFEIS” by adding a discussionof:
…TheNationalAquacultureAct [NAA]… whichappliestoallfederalagencies,statesthatitis“inthenationalinterest,anditisthenational
24
policy,toencouragethedevelopmentofaquaculturein the United States.’ . . .”41
Despitethiscomment,andtheSecretary’sstatutoryobligationtoperformhisdutiesconsistentwiththeCongressionallydeclarednationalpolicy“toencouragethedevelopmentofaquacultureintheUnitedStates,”42thereisnoreferencetotheNAAinthe “FEIS”or in the Secretary’s 2012 decisionto closeDBOC.
- PaulOlin’sparticipationasanamicusisafollow-uptohisextensivecommentscritiquingtheDEIS,includingthefactthatallofthealternativesofferedwouldforcethisalmost100yearoldenterpriseoutofbusiness.SimilartotheNMFS comments,Dr.Olinalsotargetedthefailure“toprovideavalidstatus-quobaseline,”toconsidertheenvironmentalbenefitoftheOysterFarm,and“to assessthe economic impacts of DBOCclosure . . . .”43
TheSecretary’sdecisiontodenyDBOCapermitdidnottakeintoaccountandisinconsistentwiththeforegoingfederal,stateandlocallaws,policies and mandates.
VII. SUMMARY
Marin’sagriculturalcommunitymaybesmall,butitismighty. ItisoutofthemarriageofMarin’s
41National Marine Fisheries Service letter to NPS,datedNovember 17, 2011, “FEIS” AppendixF: RelevantAgencyCorrespondence, pp.46-47.
42See16 U.S.C. 2801§§ 2(b-c), 16 U.S.C. 2802(7), and 16 U.S.C.
2805(d) (Nat’l Aquaculture Actof 1980).
43DEIS,Comment47007.
25
communityandtherestaurantsthatbegantoservefarmfreshproductsinthe1970sthatthefarm-to-tablemovementgrew.Itisoutofthiscommunitythatnewmethodsofagriculture,includingmethodsthatenhancethesustainabilityofthesoil,arebeingbirthed.ItwouldbeludicrousifitwerenotsotragicthatinMarinCounty,theveryepicenterofthesustainablefarmingmovement,thefederalgovernmentwouldseektodestroyalongestablishedoyster farm. A farmthat:
- Furnishestheregionwithhighestqualitymarineproteinwithouttheuseofpesticides,chemicalfertilizerortheuseoflargemechanized fuel consuming equipment;
- IncludesthelastoystercanneryinCalifornia,whichcananddoesprovidetheonlysourceofoystershellsusedtorestoreoysterstoSanFrancisco Bay; and
- ReturnsrevenuestotheStateandfederalgovernmentswhiletheoystersbenefittheenvironment throughfiltrationof the water.
PowerfullocalsupportfortheOysterFarmintheformofthoughtfulcommentsontheDEIS,thediversityoftheamicionthisbrief,andthehundredsofvolunteer-produced“SaveOurDrakesBayOysterFarm”signspostedaroundSanFrancisco,Marin,SonomaandNapacounties44reflecttherespectinthesecommunitiesforDBOCandtheroleitplaysinthelocalsustainableagriculturemovement.This“agriculturalenvironmentalism”isentirelyconsistentwithmodernenvironmentalistthinkingthatrecognizesthatthereremainsvirtuallynoland
26
intheworldthatisuntouchedbyhumanimpacts.
ThiscaseisanopportunityfortheCourttobringNinthCircuitdecisionsonNEPAintolinewithdecisionsinothercircuits;toclarifytheresponsibilitiesoffederalagenciesforconductingmeaningfulenvironmentalreviewbeforechanginganexistingusethatwassubjecttoenvironmental review,45andtorequireafederalagencyresponsibleformanagingextensivepubliclandstoreconsiderwhat it means “to manage nature wisely.”
VIII. CONCLUSION
The petition for writ of certiorarishouldbegranted.
Respectfully submitted,ALEXANDERD.CALHOUN
Counselof Record
TAYLOR&COMPANYLAWOFFICES,LLP
One Ferry Building,Suite 355
San Francisco, CA 94111(415) 788-8200
Counsel For Amici CuriaeWilliam T. Bagley, etal.
May 15, 2014
45Seefootnote35,supra.
27
Posted by Jane Gyorgy on May 19, 2014
https://oysterzone.wordpress.com/2014/05/19/05-19-2014-william-bagley-judith-teichman-et-al-amici-curiae-brief/
05-19-2014 PLF and Ca Cattlemen’s Association AMICUS CURIAE Brief
(Unfortunately, Adobe PDF file converter has a tendency to run words together
so I am providing access both through the link below as well as by scrolling down to read the ‘converted file.)
05-19-2014 PLF and Ca Cattlemen Assn Brief
- 13-1244
Inthe
SupremeCourtoftheUnitedStates
Ë
DRAKESBAYOYSTERCOMPANYandKEVINLUNNY,
Petitioners,
SALLYJEWELL,SecretaryoftheUnitedStatesDepartmentoftheInterior,etal.,
Ë
OnPetitionforWritofCertioraritotheUnitedStatesCourtofAppeals
fortheNinthCircuit
Ë
BRIEFAMICUSCURIAEOFPACIFICLEGALFOUNDATIONAND
CALIFORNIACATTLEMEN’SASSOCIATIONINSUPPORTOFPETITIONERS
Ë
DAMIENM.SCHIFF
*ANTHONYL.FRANÇOIS
*CounselofRecordPacificLegalFoundation930GStreet
Sacramento,California95814
Telephone:(916)419-7111
Facsimile:(916)419-7747
E-mail:dms@pacificlegal.orgE-mail:alf@pacificlegal.org
CounselforAmiciCuriaePacificLegalFoundationand
CaliforniaCattlemen’sAssociation
i
QUESTIONSPRESENTED
- WhetherthefederalcourtslackjurisdictionundertheAdministrativeProcedure Acttoreviewanagencyactionthatisarbitraryandcapriciousoranabuseofdiscretionwhenthestatuteauthorizingtheactiondoesnotimposespecificrequirementsgoverningtheexerciseofdiscretion.
- WhetherfederalagenciescanevadereviewoftheiractionsundertheNationalEnvironmentalPolicyActbydesignatingtheiractionsas“conservationefforts,”whentherecordshowsthattheactionwillcausesignificantadverseenvironmentaleffects.
- Whetheranagencycommitsprejudicialerrorwhenitmakesmateriallyfalsestatementsinanenvironmentalimpactstatement,andthenassertsthatitwouldhavemadethesamedecisionevenifthefalsestatementshadbeencorrected.
ii
TABLEOFCONTENTS
Page
QUESTIONS PRESENTED……………………………….. i
TABLE OF AUTHORITIES……………………………… iv
INTEREST OF AMICI CURIAE…………………………. 1
INTRODUCTIONANDSUMMARYOFREASONSFOR
GRANTINGTHEPETITION……………………… 3
REASONSFORGRANTINGTHEPETITION……… 6
- Bureaugrazingpermitdecisionsregulateapredominantuseofover150millionacresofthenation’sfederallands,almostallofwhichfall
withintheNinthorTenth Circuits……………… 6
- TheCourtshouldgrantthePetitionbecausetheNinthandTenthCircuitsaresplitontwolegalstandardsfor
grazing permit renewals……………………………. 9
- TheNinthCircuitholdsthatadecisionnottorenewanaturalresourcepermitisexemptfromNEPAiftheagencycharacterizesthedecisionasaconservationeffort,whiletheTenthCircuit
rejectsprecisely suchanexemption……….. 9
TABLEOFCONTENTS—Continued
- TheBureaucannotarbitrarilyorcapriciouslyrefusetorenewagrazingpermitwithoutansweringtothefederalcourtsundertheAdministrativeProcedureActintheTenthCircuit,butitcanrefuse
Page
renewalswithimpunityintheNinth. ..14CONCLUSION……………………………………… 17
TABLEOFAUTHORITIES
Cases
Page
Bacav.King,92F.3d1031(10thCir.1996) .. 15-16
CapeHatterasAccessPres.Alliancev.Dep’tofInterior,344F.Supp.2d108(D.D.C.2004) …12
CatronCountyBd.ofComm’rs,NewMexicov.
U.S.Fish&WildlifeServ.,
75F.3d1429(10thCir.1996)………. 5,11-13
CitizenstoPreserveOvertonPark,Inc.v.
Volpe,401U.S.402(1971)………………………. 14-15
DiamondRingRanch,Inc.v.Morton,
531F.2d1397(10thCir. 1976)……… 4,15-16
DouglasCountyv.Babbitt,
48F.3d1495(9thCir.1995)……….. 5,10-13
DrakesBayOysterCov.Jewell,
- 13-15227,2014WL114699
(9thCir.Jan.14,2014)……. 3-5,10-11,14,16
InrePolarBearEndangeredSpeciesActListingand§4(d)RuleLitigation,
818F.Supp.2d214(D.D.C.2011)……………….. 12
Merrellv.Thomas,807F.2d776(9thCir.1986)..10
MiddleRioGrandeConservancyDist.v.Norton,
294F.3d1220(10thCir.2002)……………………… 12
Mollohanv.Gray,413F.2d349
(9thCir. 1969). . .. . .. . .. .. . .. . .. .. . . 4,14-15
NessInv.Corpv.USDA.,ForestServ.,
512F.2d706(9thCir. 1975)…………..4,14
NessInv.Corpv.USDA,ForestService,
360F. Supp. 127 (D. Ariz. 1973)………………. 15-16
Rapanosv.UnitedStates,547U.S.715(2006)…….. 1
Sabinv.Butz,515F.2d1061
(10th Cir.1975)……………………………………… 15-16
Sackettv. E.P.A., 132 S. Ct. 1367(2012)…………….. 1
SanLuis&Delta-MendotaWaterAuthorityv.
Jewell,No.11-15871,2014WL975130(9thCir.Mar. 13,2014)…………………………………….. 10
SolidWasteAgencyofNorthernCookCountyv.
U.S.ArmyCorpsofEngineers,
531 U.S.159 (2001)……………………………………… 1
Stricklandv.Morton,
519 F.2d467 (9th Cir.1975)………………………… 14
UtahSharedAccessAlliancev.Carpenter,
463 F.3d1125 (10th Cir. 2006)……………………… 12
UtahnsforBetterTransp.v.UnitedStatesDep’t
ofTransp., 305F.3d1152(10thCir. 2002)……… 13
Rules
- Ct.R.37.2(a)…………………………………………… 1
- Ct.R.37.6………………………………………………. 1
Statutes
5 U.S.C.§701(a)(2)……………………………………….. 14
43U.S.C. §315b . .. . . . .. . . . .. . . . .. . . . . .. .4,15Pub.L.No.111-88,123Stat.2904(2009)…..3,15
Miscellaneous
Buccino,Sharon,NEPAUnderAssault:CongressionalandAdministrative
ProposalsWouldWeakenEnvironmentalReviewandPublicParticipation,
12N.Y.U.Envtl.L.J.50(2003)…………………….. 13
Bureauwebsite,availableathttp://www.blm.gov/wo/st/en/prog/grazing.html(lastvisitedMay12,2014)…………………………….. 6
PublicLandsCouncil,PublicLandsGrazing,AnIntegralSegmentoftheU.S.LivestockIndustry,availableathttp://publiclandscouncil.org/CMDocs/PublicLandsCouncil/New%20Website/Public%20Lands%20Ranching%20Overview.pdf(lastvisitedMay12,2014)……… 9
U.S.Dep’tofInterior,BureauofLandMgmt.,FiscalYear2012RangelandInventory,Monitoring,andEvaluationReport,availableathttp://www.blm.gov/pgdata/etc/medialib/blm/wo/Planning_and_Renewable_Resources/rangeland.Par.30896.File.dat/Rangeland
2012.pdf(lastvisitedMay12,2014)………………… 7
U.S.GeneralServicesAdministration,FederalRealPropertyProfileasofSeptember30,2004,Table16,at18-19,availableathttp://www.gsa.
gov/graphics/ogp/Annual_Reportl_R2M-n11_0Z5RDZ-i34K-pR.pdf
FY2004_Fina
(lastvisitedMay 12, 2014)………………………….. 7-8
PursuanttoRule37.2(a),PacificLegalFoundation(PLF)andCaliforniaCattlemen’sAssociation(CCA)respectfullysubmitthisbriefamicuscuriaeinsupportofthePetitioners.1
PLFisthemostexperiencedpublicinterestlegalorganizationadvancinganddefendingconstitutionalrightsandlimitationsongovernmentintheareaofenvironmentallaw.PLF’sattorneyshaveparticipatedasleadcounselorcounselforamiciinseveralcasesbeforethisCourtinvolvingaccesstofederalcourtsandjudicialoversightofagencyaction.See,e.g.,Sackettv.E.P.A.,132S.Ct.1367(2012);Rapanosv.United
States,547U.S.715(2006);SolidWasteAgencyofNorthernCookCounty v.U.S. ArmyCorpsofEngineers,531U.S.159(2001).
CCAisamutualbenefitcorporationorganizedunderCalifornialawin1923asan“agriculturalandhorticultural,nonprofit,cooperativeassociation”topromotetheinterestsoftheindustry.MembershipintheCCAisopentoanypersonorentityengagedinbreeding,producing,maturing,orfeedingcattle,orwholeaseslandforcattleproduction.TheCCAisthe
1PursuanttothisCourt’sRule37.2(a),allpartieshaveconsentedtothefilingofthisbrief.Counselofrecordforallpartiesreceivednoticeatleast10dayspriortotheduedateofAmiciCuriae’sintentiontofilethisbrief.LettersevidencingsuchconsenthavebeenfiledwiththeClerkoftheCourt.
PursuanttoRule37.6,AmiciCuriaeaffirmthatnocounselforanypartyauthoredthisbriefinwholeorinpart,andnocounselorpartymadeamonetarycontributionintendedtofundthepreparationorsubmissionofthisbrief.NopersonotherthanAmiciCuriae,theirmembers,ortheir counselmadeamonetarycontributiontoitspreparationorsubmission.
predominantorganizationofcattlegrazersinCaliforniaand,actinginconjunctionwithitsaffiliatedlocalorganizations,itendeavorstopromoteanddefendtheinterestsofthelivestockindustry.CCAhasseveral memberswhoranch withintheboundariesofthePointReyesNationalSeashoreunderreservationsofuse andoccupancy and/or special use permitsfromtheNationalParkService,andthesemembershaveastronginterestinensuringthattheNationalParkServicecomplieswithapplicablelawswhenactingonfuturerenewalsoftheirpermits.CCAalsohasmanymemberswhoholdfederallyissuedgrazingpermitsinmanyareas ofCalifornia,andthedecisionbelowimpactshowtheAdministrativeProcedureAct(APA)andtheNationalEnvironmentalPolicyAct(NEPA)applytoagencyactionsonthosepermits.
CCAmembersandotherfederalgrazingpermitholdersintheNinthCircuitcurrentlylackaccesstothefederalcourtsequaltothatenjoyedbyidenticallysituatedfederalgrazingpermitholdersintheTenthCircuit.And,underthedecisionbelow,federalagenciesareexemptfromNEPAwhentheyrefusetorenewCCAmembers’grazingpermitsintheNinthCircuit,whileintheTenthCircuitthesame agenciesaresubjecttoNEPA.
INTRODUCTIONANDSUMMARYOFREASONS
FORGRANTINGTHEPETITION
ThePetitionpresentsthequestionwhetherfederalcourtslackjurisdictionundertheAPAtoreviewanagencyactionforabuseofdiscretionwhentheauthorizingstatutefortheactionlacksspecificlimitationsonthescopeoftheagency’sdiscretion.Petitionat1.ThePetitionidentifiesabroadsplitamongvariousfederalcircuitcourtsonthisquestion,includingseveralspecificexamplesofcasesinwhichdifferentcircuitshavegivenconflictinganswerstothisquestioninthecontextofthesameclassofagencydecisions.Id.at14-18.
OneofthecircuitsplitslistedasabasisforgrantingthePetitionisbetweentheNinthandTenthCircuitsontheissueofAPAreviewoffederalgrazingpermitdecisions.Id.at19.Thisbriefprovidesadditionaldetailonthisissue’simportancetothousandsofranchingfamiliesacrossthenation,andwhytheCourtshouldgrantthePetitiontoresolvethiscircuitsplitaffectingtensofmillionsofacresoffederalgrazinglands.
ThedecisionbelowinvolvestheInteriorSecretary’srefusaltorenewapermitforanexistingoysterfarminanationalseashoreundersection124ofPublic Law 111-88, 123 Stat. 2904, 2932 (2009)
(Section124),andthescopeofjudicialreviewunderthatstatute.DrakesBayOysterCov.Jewell, No.13-15227,2014WL114699,at*1(9thCir.Jan.14,2014).
ThequestionspresentedinthePetitionareimportantfarbeyondthisonepermitorstatute.Thousandsofranchersgrazelivestockontensofmillionsofacresoffederallandunderrenewablefederalgrazingpermits
inthestatescomprisingtheNinthandTenthCircuits.TheBureauofLandManagement(Bureau)renewsthesepermitsundertheTaylorGrazingAct,43U.S.C.
- 315b,whichaffordstheBureauthesamebroaddiscretionthatSection124affordstheInteriorSecretary(Secretary).
DrakesBayentrenchespriorNinthCircuitcaselawholdingthatBureaugrazingpermitdecisionsarenotsubjecttoAPAreview.DrakesBayreliesonNessInv.Corpv.USDA.,ForestServ.,512F.2d706(9thCir.1975),inholdingthattheSecretary’srefusaltorenewtheoysterfarm’spermitisnotsubjecttoAPAreview.DrakesBay,2014 WL 114699,at*1,6.NessinturnreliesontheNinthCircuit’sdecisioninMollohanv.Gray,413F.2d349,352(9thCir.1969),whichholdsthatdecisionsongrazingpermitsundertheTaylorGrazingActarenotsubjecttojudicialreviewundertheAPA.SeeNess,512F.2dat716(“wesharetheviewofthepanel[]whichdecidedMollohan”).TheNinth Circuit conflictswiththe Tenth CircuitonjudicialreviewofgrazingpermitdecisionsundertheAPA.DiamondRing Ranch,Inc.v.Morton,531F.2d1397,1406(10thCir.1976)(“TheTaylorGrazingActdoesnotfallwithinthelimitedclassofnon-reviewability.”).SincealmostallfederallandsmanagedundergrazingpermitsareintheNinthorTenthCircuits,thissplitdividesvirtuallytheentirerelevantpartofthecountryforpurposesoffederalgrazingmanagement.GrantingthePetitionwillprovidethisCourttheabilitytoresolvemuchmorethanwhethertheSecretary’srefusaltorenewtheoysterfarm’spermitissubjecttoAPAreview;itwillalsoresolvethesplitbetweentheNinthandTenthCircuitsonwhetherrenewaldecisionsonmorethan
18,000grazingpermits,regulating155-millionacresoffederalland,aresubjecttoAPAreview.
ThedecisionbelowalsoholdsthattheSecretary’srefusaltorenewapermitforapre-existingactivityisnotsubject to NEPA ifthe refusalischaracterized asa“conservation effort,”relyingonthe NinthCircuit’sholdinginDouglasCountyv.Babbitt,48F.3d1495,1505-06(9thCir.1995)(criticalhabitatdesignationundertheEndangeredSpeciesActnotsubjecttoNEPAbecause“ESAfurthersthegoalsofNEPA”).DrakesBay,2014WL114699,at*12.TheNinthCircuitalsoconflictswiththeTenthCircuitontheapplicationofNEPAtoagencyactionsthatpurporttobenefittheenvironment.CatronCountyBd.ofComm’rs,NewMexicov.U.S.Fish&WildlifeServ.,75F.3d1429,1437(10thCir.1996)(environmentalconservationpurposedoesnotexemptfederalactionfromNEPA).BecauseDrakesBayextendsDouglasCountytopermitnonrenewals,itisprecedentthatNEPAdoesnotapplytorefusalstorenewfederalgrazingpermitsintheNinthCircuit.Assuch,DrakesBayalsoconflictswiththeTenthCircuit’sdecisioninCatronCounty.
TheCourtshouldgrantthePetitiontoresolvethesplitsbetweentheNinthandTenthCircuitsonwhetherapermitrenewaldecisionissubjecttoAPAreview,andwhetherNEPAappliestoarefusaltorenewapermitiftheagencycharacterizestherefusalasenvironmentallybeneficial.
REASONSFOR GRANTINGTHEPETITION
I
Bureaugrazingpermitdecisionsregulateapredominantuseofover150millionacresofthenation’sfederallands,almostallofwhichfallwithintheNinthorTenthCircuits.
LivestockgrazingunderBureaupermitsisoneofthemajorusesoffederallandinelevenwesternstatescomprisingmuchoftheNinthandTenthCircuits.TheBureau managesroughly 245-million acres of federalland.Ofthoseacres,155million—orapproximately63%—areusedforlivestock grazingundermorethan18,000Bureaupermitscovering21,000separategrazingallotments.2
Asthetablebelowshows,almostalloftheseallotmentsareineithertheNinthorTenthCircuits.WhiletheNinthCircuithasappellatejurisdictionoverabouttwo-thirdsofthefederalgrazingacreage,thenumberofgrazingpermitsisfairlyevenlydividedbetweenthetwocircuits.
2 Bureauwebsite,availableathttp://www.blm.gov/wo/st/en/prog/grazing.html(lastvisitedMay12,2014).
Circuit/State | BureauAllot-ments3 | Allot-mentAcres(millions) | %federallyownedland4 |
NinthCircuit | |||
California | 681 | 7.2 | 45.30% |
Oregon/Washington | 2,028 | 13.6 | 53.11%/30.33% |
Arizona | 820 | 11.4 | 48.06% |
Nevada | 798 | 43.4 | 84.48% |
Idaho | 2,175 | 11.5 | 50.19% |
3ThenumberofallotmentsandallotmentacreagefromtheBureau’s2012RangelandInventory,Monitoring,andEvaluationReport,Table6,availableathttp://www.blm.gov/pgdata/etc/medialib/blm/wo/Planning_and_Renewable_Resources/rangeland.Par.30896.File.dat/Rangeland2012.pdf(lastvisitedMay12,2014).
4Percentageofeachstatewhichisfederallyowned,fromU.S.GeneralServicesAdministration,FederalRealPropertyProfileasofSeptember30,2004,Table16,at18-19,availableathttp://www.gsa.gov/graphics/ogp/Annual_ReportFY2004_Final_R2M-n11_0Z5RDZ-i34K-pR.pdf(lastvisitedMay12,2014).
Montana/Dakotas5 | 5,222 | 8.2 | 29.92%/4.49% |
TotalNinthCircuit | 11,724 | 95.3 | 48.58% |
TenthCircuit | |||
NewMexico | 2,282 | 12.8 | 41.77% |
Utah | 1,393 | 21.6 | 57.45% |
Wyoming | 3,531 | 17.6 | 42.33% |
Colorado | 2,416 | 7.9 | 36.63% |
TotalTenthCircuit | 9,622 | 59.9 | 43.77% |
ThisdatashowsthatabouthalfofthelandinthewesternUnited States isfederallyowned.Accordingto the U.S. General ServicesAdministration, grazingisthesecondmostpredominantspecificuseoffederallands,6andthefivestateswiththelargestfederallandholdingsareallintheNinthCircuit.AccordingtothePublicLandsCouncil,anorganizationofstateandnationalcattle,sheep,andgrasslandassociations,
5Montana,intheNinthCircuit,andtheDakotas,intheEighthCircuit,aremanagedbyoneBureaustateoffice,anddataonallotmentsandacresexclusivelyforMontanaarenotreadilyavailable.ThelowpercentageoffederallandintheDakotassuggeststhatmostoftheallotmentsandgrazingacresshownareinMontana.ThetotalsfortheNinthCircuitstatesincludethecombinedallotmentandallotmentacresfiguresforMontanaandtheDakotas,butdonotincludetheDakotasinthetotalpercentageoffederallandownedintheNinthCircuitstates.
6 FederalRealPropertyProfile2004,supra,Table14,at16.
approximately40%ofthebeefcowsinthewesternUnitedStates,andhalfofthenation’ssheepherds,spendsometimeingrazingallotmentsonpubliclands.Averylargenumberofruralcommunitiesaredependentonfederallypermittedgrazingforemployment,commerce,andtaxrevenuetosupportpublicservices.7
WiththeNinthandTenthCircuitseachgoverningabouthalfofallfederalgrazingpermits,thesetwocircuits mustbealigned on fundamentalquestions oflawrelatingtorenewalofgrazingpermits,includingtheapplicationofNEPA,andjudicialreviewundertheAPA.
II
TheCourtshouldgrant
thePetitionbecausetheNinthandTenthCircuitsaresplitontwolegalstandardsforgrazingpermitrenewals.
- TheNinthCircuitholdsthatadecisionnottorenewanaturalresourcepermitisexemptfromNEPAiftheagencycharacterizesthedecisionasaconservationeffort,whiletheTenthCircuitrejectspreciselysuchanexemption.
Bycharacterizingtherefusaltorenewafederalgrazingpermitasaconservationaction,theBureauneednotcomplywithNEPAforpermitsthroughout
7PublicLandsCouncil,PublicLandsGrazing,AnIntegralSegmentoftheU.S.LivestockIndustry,availableathttp://publiclandscouncil.org/CMDocs/PublicLandsCouncil/New
%20Website/Public%20Lands%20Ranching%20Overview.pdf(lastvisitedMay12,2014).
10
theNinthCircuit,includingjustinsidetheeasternbordersofArizona, Nevada,andIdaho.But,theagencymustcomplywithNEPAforidenticaldecisionsintheneighboringTenthCircuitstatesofNewMexico,Utah,andWyoming.
Thedecisionbelowholdsthatafederalagency’srefusaltorenewanexistingpermitisnotsubjecttoNEPAiftherefusalpurportstobea“conservationeffort,”evenwheretherecordshowsthatfailuretorenewhasadverseimpacts. DrakesBay,2014WL114699,at*12.8DrakesBayechoestheNinthCircuit’sdecisioninDouglasCounty,48F.3dat1506(designationofcriticalhabitatundertheEndangeredSpeciesActexemptfromNEPAbecausehabitatdesignationfurthersNEPA’spurpose).DrakesBayandDouglasCountybothrestontherationalethatactionsintendedtobenefittheenvironmentshouldnotbesubjectedtothe“obstructionisttactic”ofcomplyingwithNEPA.DrakesBay,2014WL114699,at*13(citingDouglasCounty,48F.3dat1508).
DouglasCountyaddressedtheapplicationofNEPAtocriticalhabitatdesignationsasanissueoffirstimpressionin1995.48F.3dat1501.DouglasCountyfirstheldthatdesignationofcriticalhabitatisexemptfromNEPAbyanalogizingtoMerrellv.Thomas,807F.2d776,778-80(9thCir.1986),which
8TheNinthCircuitrecentlystatedinSanLuis&Delta-MendotaWaterAuthorityv.Jewell,No.11-15871,2014WL975130,at*54(9thCir.Mar.13,2014),thatDrakesBaydoesnot“stand forthepropositionthateffortstopreservethenaturalenvironmentareperseexemptfromNEPA.”But,thisispreciselywhatDrakesBaydoessay.DrakesBay,2014WL114699,at*12(“TheSecretary’sdecisionisessentiallyanenvironmentalconservationeffort,whichhasnottriggeredNEPAinthepast.”).
11
heldthatproceduresthatduplicateorpreventcompliancewithNEPAindicatecongressionalintenttoexempttheprocessfromNEPA.9DouglasCounty,48F.3dat1502-04.DouglasCountyalsoheldthatNEPAdoesnotapplytocriticalhabitatdesignation“becausetheESAfurthersthegoalsofNEPAwithoutdemandinganEIS.”Id.at1506.ThisholdinginDouglasCountyreliesonthepropositionthatNEPAdoesnotapplytofederalactionsthatdonothingtoalterthenaturalphysicalenvironment.Id.at1505-06(“[W]henafederalagencytakesanactionthatpreventshumaninterferencewiththeenvironment,itneednotprepareanEIS.”).
TheTenthCircuitcomprehensivelyreviewedDouglasCountyinCatronCountyBd.ofComm’rs,NewMexicov.U.S.Fish&WildlifeServ.,75F.3dat1435-38,andrejecteditentirely,includingthe“conservationeffort”holding.TheTenthCircuitdirectlyrejectedthepropositionthatprojectsintendedtobenefittheenvironmentshouldnotbesubjecttoreviewunderNEPA,becausethisbegsthequestionthatNEPAisspecificallyenactedtoanswer.Id.at1437.AmorerecentdecisionoftheTenthCircuitfollowsCatronCountyinholdingthatNEPAappliestocriticalhabitat
9DouglasCountyalsoofferstheputativeassurancethatexcusingafederalagencyfromNEPAincriticalhabitatdesignationswouldnotyield“uncheckeddiscretioninmakingcriticalhabitatdesignations,”since“theproceduralrequirementsoftheESA,combinedwithreviewofdecisionspossibleundertheAdministrativeProcedureAct,areadequatesafeguards.”48F.3dat1505.Yetwhilethedecisionbelowreliesonthe“conservationeffort”holdingofDouglasCountytoexemptarefusaltorenewapermitfromNEPA,thesamedecisionalsoholdsthatthereisnojurisdictiontoreviewtherefusalundertheAPA.DrakesBay,2014WL114699,at*1.
12
- MiddleRioGrandeConservancyDist.v.Norton,294F.3d1220,1230(10thCir.2002)(FishandWildlifeServicerequiredtoprepareEIStodesignatecriticalhabitatforsilveryminnow.).10
TheUnitedStatesDistrictCourtfortheDistrictofColumbiaalsofollowedCatronCountyinrejectingthegovernment’sassertionthatNEPAdoesnotapplytocriticalhabitatdesignations.CapeHatterasAccessPres.Alliancev.Dep’tofInterior,344F.Supp.2d108,136(D.D.C.2004)(becausecriticalhabitatdesignationsignificantlyaffectsthehumanenvironment,governmentmust“determinetheextentoftheimpactincompliancewithNEPA”).Inanothercase,thesamecourtrejectedtheSecretary’sarguments,basedonDouglasCounty,thatNEPAdoesnotapplytoSpecialRulesunderSection4(d)oftheESA,andheldthatNEPArequiresatleastthepreparationofanEnvironmentalAssessment.InrePolarBearEndangeredSpeciesActListingand§4(d)RuleLitigation,818F.Supp.2d214,236-38(D.D.C.2011)
(citingandapplyingreasoningofCatronCountytoESASection4(d)SpecialRules).
ThecircuitsplitbetweentheNinthandTenthCircuitsonNEPAcreatesregionallegalvariationsforrenewalofgrazingpermits,inwhichpermitsintheNinth Circuit are exposed to greater risk of
10 InUtahSharedAccessAlliancev.Carpenter,theTenthCircuitruledthatclosureofcertainpubliclandstooff-roadvehicleswasnotsubjecttoNEPA,and commented in a footnotethatifthepartieshadarguedthattheclosurewereamajorfederalaction,therationaleofDouglasCountymightapply.463F.3d1125,1136n.4(10thCir.2006).ThisdiscussionistangentialatbesttotheNEPAholdinginUtahSharedAccess,andthecasedoesnotexamineDouglasCountyinanydepth.
13
- AmicusCCAmembersholdmanyofthe572federalgrazingpermitsissuedbytheBureauinCalifornia.BecausetheNinthCircuitexcusesagenciessuchastheBureaufromcomplyingwithNEPAwheretheagencypurportstoacttoimprovetheenvironment,theBureauhasanincentivetoavoidNEPAresponsibilitiesbythesimpleexpedientofrecastingeveryrefusaltorenewapermitasenvironmentallybeneficial.ThelackofaNEPAanalysisin suchcircumstanceshamstringspermitholdersandmembersofthepublicintheirefforttolearnmoreaboutthedecision,provideinput,andtesttheassertionthatthedecisionisbeneficial.SharonBuccino,NEPAUnderAssault:CongressionalandAdministrativeProposalsWouldWeakenEnvironmentalReviewandPublicParticipation,12
N.Y.U.Envtl.L.J.50,53(2003)(“CourtshaveconsistentlyrecognizedNEPA’sdualgoalsof‘informeddecisionmakingandinformedpubliccomment.’”)(citingUtahnsforBetterTransp.v.UnitedStatesDep’tofTransp.,305F.3d1152,1163(10thCir.2002)).Excusingagenciesthatpermitthe useofnaturalresourcesonpubliclandsfromcomplyingwithNEPAiftheyrefusetorenew(whilerequiringcompliancewithNEPAforrenewingthesamepermits)improperlytipsthebalancetowardnonrenewal.
Meanwhile,federalgrazingpermitholdersinthestatescomprisingtheTenthCircuitarefreeofthischicanery,becauseCatronCountyrejectsDouglasCounty’s“conservationeffort”holding.TheCourtshouldgrantthePetitiontoestablishauniformnationalrulefortheapplicationofNEPAtoagencyrefusals torenewpermits,whentheagencycontendstherefusalsare“conservationefforts.”
- TheBureaucannotarbitrarilyorcapriciouslyrefusetorenewa
grazingpermitwithoutanswering tothefederalcourtsundertheAdministrativeProcedureActin theTenthCircuit,butitcanrefuserenewalswithimpunityintheNinth.
TheNinthCircuithasdisclaimedjurisdictionundertheAdministrativeProcedure Acttoreviewanarbitraryorcapriciousrefusaltorenewanexistinggrazingpermit.SeeMollohanv.Gray,413F.2dat352(decisionsorrefusalstoissueorrenewagrazingpermitundertheTaylorGrazingActarenotsubjecttoreviewundertheAPA).FollowingthisCourt’ssubsequentdecisioninCitizenstoPreserveOvertonPark,Inc.v.Volpe,401U.S.402,410(1971),that5
U.S.C.§ 701(a)(2)deprives federalcourts ofAPAjurisdictiononly“inthoserareinstanceswhere‘statutesaredrawninsuchbroadtermsthatinagivencase there isnolaw to apply,’” (citationomitted),theNinthCircuitre-examinedandaffirmedtheprinciplesinMollohan,holdingthatfederalcourtslackedjurisdictiontohearachallengetothedenialofahomesteadapplicationundertheClassificationandMultipleUseActof1964.Stricklandv.Morton,519F.2d467,468-70(9thCir.1975).SeealsoNess,512F.2dat716(“wesharetheviewofthepanel[]whichdecidedMollohan”).Inturn,DrakesBayreliesonNessinholdingthattheSecretary’srefusaltorenewPetitioner’spermitisnotreviewableundertheAPA.DrakesBay,2014WL114699,at*6.11
11 EvenwithoutitsrelianceonNessandMollohan,DrakesBay
isprecedentthatarefusaltorenewagrazingpermitisnot
(continued…)
WhentheBureauarbitrarilyorcapriciouslyrefusestorenewagrazingpermitintheTenthCircuit,thefederalcourtshavejurisdictiontoreviewtheactionundertheAdministrativeProcedureAct.DiamondRingRanch,Inc.v.Morton,531F.2dat1406,statessquarelythat“[t]heTaylorGrazingActdoesnotfallwithinthelimitedclassofnon-reviewability,seeSabinv.Butz,515F.2d1061,1064-65(10thCir.1975).”
SabindeclinestofollowMollohan.515F.2dat1065(federalcourtshavejurisdictionundertheAPAtoreviewForestServicerefusaltoissueapermitforskiinstruction).InSabin,theTenthCircuitconstruedCitizenstoPreserveOvertonParknarrowly,butnotedthebroaderinterpretationofthefederaldistrictcourtinNessInv.Corpv.USDA,ForestService,360F.Supp.127(D.Ariz.1973).12
11 (…continued)
reviewableundertheAPA.Bothofthefederalstatutes,forrenewalofPetitioner’sspecialusepermitinthePointReyesNationalSeashore,andforrenewalofgrazingpermitsonfederalland,extendverybroaddiscretiontotherelevantagencytograntordenypermits.ComparePub.L.No.111-88,§124,123Stat.2904,2932(2009)(“Section124”inthedecisionbelow)(“[T]heSecretaryoftheInteriorisauthorizedtoissueaspecialusepermitwiththesametermsandconditionsastheexistingauthorization[.]”),with43U.S.C.§315b(“Such[grazing]permitsshallbeforaperiodofnotmorethantenyears,subjecttothepreferencerightofthepermitteestorenewalinthediscretionoftheSecretaryoftheInterior….”).
12Bacav.King,92F.3d1031,1037(10thCir.1996),citesMollohanfortheinabilityofthecourtstoorderBureautorenewagrazingpermit.TheplaintiffinBacawaschallengingalandexchangeundertheFederalLandPolicyandManagementAct,id.at1032,thatledtothecancellationofhisgrazingpermit,id.at1033.TheTenthCircuitruledthattheplaintifflackedstandingbecausehisinjurieswerenotredressablebasedonthereliefhe
(continued…)
16
DrakesBayreliesonNess(noAPAreviewofdenialofForestServicepermit),whichreliesinturnonMollohan(noAPAreviewofcancellationofgrazingpermit).TheseNinthCircuitdecisionsconflictwiththeTenthCircuit’sdecisionsinSabin(APAreviewofdenialofForestServicepermit)andDiamondRingRanch(APAreviewofgrazingpermitdecision).So,grantingthePetitionwillnotjustresolvewhethertheSecretary’srefusaltorenewPetitioners’permitissubjecttoAPAreview.GrantingthePetitionwillresolvethecircuitsplitsonAPAreviewofgrazingpermits (Mollohan/DiamondRingRanch) andForestServicediscretionarypermits(Ness/Sabin).
ThecircuitsplitonAPAreviewofgrazingpermitdecisionsresultsinatypeofsecond-classcitizenshipforgrazingpermitholdersintheNinthCircuit.TheyholdapermitwhichtheBureaucanarbitrarilyorcapriciouslyrefusetorenew,foranyreasonornoreason,withoutbeingaccountabletothefederalcourtsundertheAPA.Grazingpermitholdersin theTenthCircuit,however,areabletobringidenticalrefusalsbeforethefederal courtsundertheAPA.Asaresult,grazingpermitholdersintheTenthCircuithaveamoreusefulandvaluableFirstAmendmentrighttopetitiontheirgovernment,becausetheycanpetitionboththeExecutiveandJudicialBranches.ThoseintheNinth,meanwhile,mayonlypetitionthesameExecutiveBranchagencythatrefusestorenewtheirpermits,secureintheknowledgeitisunaccountabletothefederalcourts.
12 (…continued)
- Id.at1037.TheplaintiffhadnotdirectlychallengedthecancellationofhispermitundertheAPA,onlythelandswap.
17
TheCourtshouldgrantthePetitiontoeliminatethisregionallybasedsecond-classcitizenshipforgrazingpermitholdersandestablishauniformruleofjurisdictionundertheAPA.
CONCLUSION
TheCourtshouldgrantthePetition.DATED:May,2014.
Respectfullysubmitted,
DAMIENM.SCHIFFANTHONYL.FRANÇOIS
CounselofRecordPacificLegalFoundation930GStreet
Sacramento,California95814
Telephone:(916)419-7111
Facsimile:(916)419-7747
E-mail:dms@pacificlegal.orgE-mail:alf@pacificlegal.org
CounselforAmiciCuriaePacificLegalFoundationandCaliforniaCattlemen’sAssociation
Posted by Jane Gyorgy on May 19, 2014
https://oysterzone.wordpress.com/2014/05/19/05-19-2014-plf-and-ca-cattlemens-association-amicus-curiaebrief/
05-19-2014 Monte Wolfe Foundation Amicus Curiae Brief
(Unfortunately, Adobe PDF file converter has a tendency to run words together
so I am providing access both through the link below as well as by scrolling down to read the ‘converted file.)
05-19-2014 Monte Wolfe Foundation DBOC brief
NO.13-1244
INTHE
SupremeCourtoftheUnitedStates
DRAKES BAY OYSTER COMPANY, et al.,
Petitioners,
SALLY JEWELL, SECRETARY OF THE UNITED STATES DEPARTMENT OF THE INTERIOR, et
On Petition ForWrit Of Certiorari To The United States Court Of Appeals
ForThe Ninth Circuit
AMICUS CURIAE BRIEF OF THE MONTE WOLFE FOUNDATION
IN SUPPORT OF PETITIONERS
JAMESTALCOTTLINFORD
Counsel of Record
ATTORNEYATLAW
42RHINESTONE TERRACESANRAFAEL,CA94903(415) 831-8761
TABLE OF CONTENTS
Table of Authorities iii
Identity and Interest of Amicus Curiae 1
Summary of the Argument 2
A:Thedecision’simplicationsforfederal stewardshipofhistoricresourcespose an imminent threat to “other litigants
in other situations” 4
1) A hypothetical example of Drakes BayOyster’s threat to historic resources 4
2) Evenifthejurisprudentialsourceof DrakesBayOysterwerestillgood law, it would only be good in the
Ninth Circuit, where the threat is posed. 6
B:DrakesBayOyster’sNEPAholdingcreatesanintolerablesplitthatencouragesnon-acquiescenceby Federal agencies in their stewardship
of historic resources 7
C:TheNinthCircuithasrecentlyminim- izedDouglas County’sapplicabilitytoESAhabitatdesignationswhile upholding “the reasoning” of Douglas
County andDrakes Bay Oyster 10
D:DrakesBayOyster’sanomalous holdingisoddenoughtosuggest havingbeen,insomesubtleway,a resultofconfutingtheNational Environmental Policy Act with the
Wilderness Act. 13
CONCLUSION 18
APPENDIX
- NationalHistoricPreservationActof1966 (NHPA) 16 U.S.C. 470, etseq. (excerpts)
- RegulationsoftheAdvisoryCouncilonHistoric Preservation(ACHP)“ProtectionofHistoric Properties” 36 CFR Part 800 (excerpts)
- RegulationsoftheCouncilofEnvironmental Quality (CEQ), 40 CFR 1500-1508 (excerpts)
iii
TABLE OF AUTHORITIES
P.APP.=Petitioner’sAppendix;MWF.APP.=Amicus’sAppendix
Cases
Blonder-Tongue Laboratories, Inc. v. University of IllinoisFoundation,
402 U.S. 313, 320 n.6 (1971) 3
Caltron County v. U.S. Fish & Wildlife
Service,75 F.3d 1429(10thCir. 1996) 6, 11
Douglas County v. Babbitt,
48F.3d1495(9thCir. 1995) 2, 6, 7, 10-13
Drakes Bay Oyster Company v. Jewell, 792F.3d967 (9thCir.2013),
[PACERref:9thCir.Case13-15227;
DktEntry:100;Pages2-51]P.APP.2-51 passim
High Sierra Hikers v. Blackwell,
390F.3d 630 (9thCir. 2004) 16
San Luis & Delta-Mendota Water
Authorityv.Jewell,
F.3d
(9th
Cir–3/13/2014).[PACERref:9thCir.Case 11-15871; DktEntry: 118-1;
Pages 1-173] 11-13
Summers v. Earth Island Inst.,
555 U.S. 488 (2009) 15
Wilderness Watch v. USF&W
629F3d 1024 (9thCir 2010) 16
Statutes
Endangered Species Act of 1973 (ESA)
7 U.S.C. §136, 16 U.S.C. §1531 etseq.
[referenced but not cited] 6, 10
National Environmental Policy Act of 1969(NEPA) 42 U.S.C. §4321 etseq.
[P.APP.171-177;excerpts] passim
National Historic Preservation Act of 1966 (NHPA) 16 U.S.C. §470 etseq
[MWF.APP.2;excerpts] 1, 3, 4, 7, 8
Point Reyes Wilderness Act of 1976 Pub.L.No. 94-544, 90 Stat.2515
[referenced but not cited] 16
Wilderness Act of 1964, 16 U.S.C. 1131-1136
[referenced but not cited] 16
42 U.S.C. §4331(a) | 17 |
42 U.S.C. §4331(b)(3), (4) & (6) | 2, 4 |
42 U.S.C. §4331(b)(4) | 2, 4, 9, 17 |
Regulations
Advisory Council on Historic Preservation (ACHP)36 CFR Part 800
[MWF.APP.3-9;excerpts] 8, 16
Council on Environmental Quality (CEQ) 40 CFR 1500-1508
[MWF.APP.9-15;excerpts] 7, 8, 9, 12
IDENTITY AND INTEREST OFAMICUS CURIÆ 1
TheMonteWolfeFoundationisaCalifornianon-profitpublicbenefitcorporationwithamission toprotectlogcabinsinourwesternmountains.2LogcabinsareaniconicAmericanvernacular architecture.However,itisnotunknownfor officialswithinfederalagenciestodecide, unilaterallyandwithoutnotice,toburnor otherwisedemolishsuchhistoricresources. Althoughhistoricresourcesgenerallybenefitfrom areviewprocessundertheNationalHistoric PreservationActof1966(NHPA),someofthem,
1: PursuanttoSupremeCourtRule37.6,AmicusMonteWolfeFoundation(“Amicus”)affirmsthat(1)thepresentamicusbriefwasauthoredentirelybycounselforAmicus,andnotauthored inwholeorinpartbycounselfora partynorbyanyoneelse,and(2)nocounselorpartyotherthanAmicusanditscounselmadeanymonetaryorothermaterialcontributiontothepreparationandsubmissionofthepresentamicusbrief.
Amicusfurtheraffirms,pursuanttoRule37.1,thatallcounsel of recordreceived timely notice of the intent tofilethepresentbriefandallgavewrittenconsenttoitsfiling.
2:AcoremissionoftheFoundationistopreservetheMonteWolfeCabin,aspecificlogcabinlocatedwithintheMokelumneWildernessAreaintheCentralSierraNevadaMountains.However,sincetheForestServicehasdeterminedthattheMonteWolfeCabiniseligibleforlistingontheNationalRegisterofHistoricPlaces,itisundertheaegisoftheNationalHistoricPreservationAct.of1966(NHPA),specificallyits§106(16U.S.C.§470f).TheMonteWolfeCabinitselfisthusnotdirectlyatriskfromtheconsequencesoftheNinthCircuitdecisionthatpromptedthepresentpetitionforcertiorari.
havinggonethroughNHPAreviewonlytobefound ineligibleforlistingontheNationalRegisterof HistoricPlaces,donotbenefitfromNHPA protection.However,theseotherwiseunprotected historicresourcesshouldbenefitfromaparallel processundertheNationalEnvironmentalPolicy Actof1969(NEPA)(42U.S.C.§4321etseq.).OneofthegoalsofNEPAisto“preserveimportant historic…aspectsofournationalheritage.” 42
U.S.C.§4331(b)(4)[PETITIONERS’APPENDIX,“P.APP.”below,p.171].TheNinthCircuitdecisionchallengedherewouldfrustratethatgoalbyimperilingunlistedlogcabinswithinAmicus’s scope of concern.
SUMMARY OF THE ARGUMENT
DrakesBayOysterCompanyv.Jewell,792F.3d 967(9thCir.2013),P.APP.2-51,holdsthatthereisnoNEPAreviewforthedecisiontoclosetheoyster farm and destroy its structures:
[It]isessentiallyanenvironmentalconser- vationeffort…[b]ecauseremovingtheoyster farmisasteptowardrestoringthe“natural, untouchedphysicalenvironment”[andit]… “protectstheenvironmentfromexactlythe kindofhumanimpactsthatNEPAisdesigned to foreclose.”
- at984,P.APP.30-31,quotingDouglasCountyv.Babbitt, 48 F.3d 1495, 1505, 1507
(9th Cir.1995).
Theholding,thatnoNEPAreviewisneededwhere agencyactionseekstorestoreapristinestateof nature,appearsuniquetotheNinthCircuit. It
meansthathistoricresourcesonNinthCircuit federalwildlandsareendangeredbecausethey cannotdependonNEPAforprotection.Absentotherprotection,theymaybe–indeed,given DrakesBayOyster’sreadingoftheintentofNEPA,should be – summarily removed.
AlthoughtheNHPAdoesyeoman’sworkin protectingthemostnotableofournation’s federally-ownedhistoricresources,itcannotreach all that are worthy of protection.
DrakesBayOysterwouldhavesucha disastrouseffectonthoseofustryingtopreserve logcabinswithinourwesternwildlandsthat DrakesBayOysterhastransformedusinto“other litigantsinothersituations.”Anditisprecisely our“othersituation”thatwillbegintheargument whythe petitionshould be granted.3
However,theactualcasebeforetheCourtalso containsanirreplaceable,uniquehistoricresource thatwouldbedestroyediftheoysterfarmwereto beremoved,the“hangingcultch”oysterracksofDrakesEstero.Howthispreciousresourceslipped betweenthecracksofanNHPAprocesswillbe addressedbelow,butforpurposesofthis introduction, it is sufficient to affirm that many
3 ThehistoricresourceargumentinsupportofthequestionofNEPAreviewwasnotraisedbelowuntilthetimeofthepetitionforrehearing.(CompareBlonder-TongueLabs.v.Univ.Illinois Foundation,402U.S.313,319-320,n.6(1971).)However,thedisastrousimpactofDrakes Bay Oysteronhistoricpreservationinfederalwildlandscouldwellsupportprudentialconsideration.Furthermore,therewouldbenoadvisoryopinionontheargumentsincePetitionerisactuallythreatenedwiththedestructionofitsownhistoricresource,the“hangingcultch”oysterracksofDrakesEstero.
valuablehistoricresourcesfailtomeetNHPA’s rigorousstandards,andthosethatdofailarelefttotheprotectionofNEPA.AmongNEPA’sgoalsisto “preserveimportanthistoric…aspectsofour nationalheritage.”42U.S.C.§4331(b)(4) P.APP.171.TheholdinginDrakesBayOysterwould prevent NEPA from reaching that goal.
A:Drakes Bay Oyster’simplications forfederalstewardshipofhistoricresourcespose animminentthreattootherlitigantsinother situations.
Thedemonstrationoftheimminentthreatthat DrakesBayOysterpresentstohistoricresourcesin wildlands begins with a hypothetical example:
1: A hypothetical example of Drakes BayOyster’s threat to historic resources
Imaginearusticlogcabinthathasbeenused sincetheearlydecadesofthelastcenturyby stockmenwhodrivetheirherdstothehighcountry everyyearforsummergrazing.Thecabinison federalland.Theagencythatadministers thatlandfollowstheadviceofhistoricpreservation officialsbymakinganinventoryofpossiblehistoric resourcesunderitssupervision.Anhistoric resourcesprofessionalevaluatesthecabinto determineitseligibilityforlistingontheNational Register.Theagencyhistorianfindsthatitwould beeligible,exceptthatseveralelementsdefeatthe integrityoftheresourcebecausetheyareadditions madewithinthepastcoupleofdecades. Theyare
thusoutsidethe“periodofhistoricsignificance”of fiftyyearsormore,generallyneededtoqualifyfor listing on the National Register. In thishypotheticalcase,imaginethatonenon-conforming elementconsistsofrecently-installedcoppertubing laiddowntobringwaterfromaspringtoasink andsideboard.4 However,thestockmen,whouse thecabineverysummer,liketheirwatersystem anddonotseethepointofremovingit. Asaresult, an historic resource with “impeccable bones” is found ineligible for listing on the National Register. Since Drakes Bay Oyster, this ineligible but valuableresourcewouldreceivedifferenttreatment dependingwhetheritbein,forexample,theUinta MountainsofUtahandWyoming,ortheWarner
Mountains of Oregon and California.
TheTenthCircuitrejectsthejurisprudential linethatincludesDrakesBayOyster.Iftheagency administeringthelandwantedtoremovethecabin, itwouldneedaNEPAreviewthatwouldbringthe stockmeninonthedecision.NEPAreviewwould alsobring in the historic preservation community.
IntheNinthCircuit,DrakesBayOysterwould allowtheagencytoremovethecabinwithoutany warning.Onesummer,thestockmenwouldarrive attheirsummercamptofindthecabingone.Andthe historic preservation community would be confrontedwiththedestructionofyetanother irreplaceable historic resource.
4 Thishypotheticalisrealistic:Justsuchacoppertubingwater systemhadtoberemovedfromtheMonteWolfeCabinsitebeforetheForestServicehistoriancouldfindtheCabineligibleforlistingontheNationalRegister.
Alloftheineligiblehistoricresourceswithin NinthCircuitwildlandsareunderimminent threat.
2:EvenifthejurisprudentialsourceofDrakesBayOysterwerestillgoodlaw,itwouldonlybegoodintheNinthCircuit,where the threat is posed.
DrakesBayOysterreliesuponandenlargesthe holdingofthe1995NinthCircuitopinion,Douglas County, supra.Douglas County’sinnovationwasto holdthatNEPAreviewisnottriggeredbythe designationofendangeredspecieshabitatunder theEndangeredSpeciesActof1973(ESA).The rationalewasthatmeredesignationdoesnot physicallychangetheenvironment,andthe designatingagencycannotbeaskedtoundertake NEPAreview“inordertoleavenaturealone.” Douglas County, supra, 48 F.3d at 1505.
However,fromthebeginning,DouglasCounty hasbeencriticizedandexpresslyrejectedbyother Circuits.ThefirstandbestexamplewasCaltronCountyv.U.S.Fish&WildlifeService,75 F.3d 1429 (10thCir.1996), holdingthat they
disagreewiththe[NinthCircuit]panelthatno actualimpactflowsfromthecriticalhabitat designation….Therecordinthiscase suggeststhattheimpactwillbeimmediateand theconsequencescouldbedisastrous[by precluding proper flood control].
Ibid. at 1436.
We will see below how the Ninth Circuit has recentlybackedoffitspositionofnoNEPAreview
forcriticalhabitatdesignation,althoughwithout backingupfarenoughtooverturnDouglasCounty. However,thepertinentpointhereisthatDouglas CountyhasneverbeengoodlawintheTenthandotherCircuits,althoughitremainsvalidprecedentintheNinth.SinceDrakesBayOysterrelieson DouglasCounty,DrakesBayOystercannotbe considered good law outside the Ninth Circuit.
WithDrakesBayOysterthereisanintolerablesplit between the Circuits.
B:DrakesBayOyster’sNEPAholdingcreatesanintolerablesplitthatencouragesnon- acquiescencebyfederalagenciesintheir stewardship of historic resources.
DrakesBayOyster’sNEPAholdingputs administrativeagenciesinabind,especiallyforhistoricresourcesfoundineligibleforlistingonthe NationalRegister.Iftheresourceisfoundeligible forlisting,thenitisprimarilyundertheaegisof theNHPA,andNEPAbecomesofsubsidiaryimportance.Ifitisineligible,theNHPAbowsout of the NEPA process.
Assumethatatypicalfederalagencywith responsibilityformanagingfederalwildlands–the ForestService,theNationalParkService,andthe BureauofLandManagementcometomind– wantstopromulgateagencyprocedureswith respecttoman-madehistoricresources,suchaslogcabins,in wildlands it administers.
Generally,theNEPAprocessinvolvesfirst,an Environmental Assessment (EA) [see 40CFR1508.9, Amicus Monte Wolfe Foundation
Appendix,“MWF.APP.”below,p.12]leadingtothedecisioneithertoproduceafullEnvironmental ImpactStatement(EIS)[see§1508.11,MWF.APP.12]ortoissueaFindingofNoSignificantImpact(FONSI)[see§1508.13,MWF.APP.13].HoweversomeclassesofactionsneverevengetanEAbecausetheyarethesubject ofaCategoricalExclusion(CE)[see§1508.4,MWF.APP.11]
IntheNinthCircuit,theDrakesBayOyster holdingwouldimplyaCEforanyremovalof historicresourcesfromwildlands,thusnoEAor EIS.BeyondthereachofDrakesBayOyster,therewouldbenoCE,rathertherewouldbeanEAandeventuallyanEIS.However,thisdifference betweenthecircuitswouldhavenopractical consequenceforhistoricresourcesthathavenotyet beenevaluatedunderNHPA:AspartoftheNEPA reviewprocess,theNHPArequirestheagencyto identify possible historic resources (36CFR800.3(a),MWF.APP.3),arequirementthattrumpsanyCategoricalExclusionthatwouldotherwiseprecludeNEPAreview.36CFR800.8(b), MWF.APP.5.Thus,intheNinthCircuitaswellasintheothers,theunevaluatedresourcewouldbe undertheprotectionofNHPA,atleastuntil determinationofeligibilityforlistingonthe National Register.
DrakesBayOyster’sthreattoanhistoric resourcewouldbecomeactualonlyiftheresourceis foundineligibleforlistingontheNationalRegister, thus solely protected by NEPA.
NEPAdoesprovideforprotectionofhistoric resources independently of NHPA. In the
definitionof“Significantly,”theCouncilon EnvironmentalQuality(CEQ)regulationsrequire consideration of adverse effects on resources
listedinoreligibleforlistingintheNational RegisterofHistoricPlacesor…lossor destruction of significant … historical resources. 40CFR1508.27(b)(8),MWF.APP.15.(Emphasis
Supplied.)
AndhistoricpreservationitselfisanexplicitstatutorygoalofNEPA.Itcallsforgovernmental action that will
attainthewidestrangeofbeneficialusesof theenvironmentwithoutdegradation…; preserveimportanthistoric,culturalandnaturalaspectsofournationalheritage,… [and]enhancethequalityofrenewable resources.
42U.S.C.§4331(b)(3),(4)&(6),P.APP.172-
- (Emphasis supplied.)
Under 40 CFR 1507.3(b)(2), MWF.APP.10-11,
thetypicalagencypromulgatesprocedures regardinggivenclassesofaction,forexample,here, anydecisiontoremoveineligiblehistoricresources from wildlands.
ForwildlandsoutsidetheNinthCircuit,the agencywilllooktothepotentialeffectsofthe action,where,forexample,theeffectsare “ecological…,aesthetic,historic,[or]cultural….”
40CFR 1508.8, MWF.APP.12.Theagency willthenbelikelytodeterminethat,giventhe complexityofeffects,aCategoricalExclusionwould beinappropriate,thatthereshouldbean EnvironmentalAssessmentthatwouldlikelyleadto a full Environmental Impact Statement.
However,forineligiblehistoricresourcesin wildlandswithintheNinthCircuit,theagencywill beboundbytheDrakesBayOysterholding:Iftheeffectis“restoringuntouchedphysical environment,”theagencyshoulddispensewiththe NEPAprocess.DrakesBayOyster,supra,729F.3d at984,P.APP.30-31.DrakesBayOysterimpliesthatthereshouldbeaCategoricalExclusion, precludinganyEAorEIS.NoNEPAoranyother processwouldbeneededtoremoveanineligible historicresourcefromwildlands.Thehistoric resource would face an imminent threat.
Thus,thetypicalfederalagencywouldfindit impossibletopromulgatethesameproceduresfor ineligiblehistoricresourcesonwildlandswithinthe NinthCircuitasforthosewithinotherCircuits. There is an intolerable split.
C:TheNinthCircuithasrecentlyminimized DouglasCounty’sapplicabilitytoESAhabitatdesignations,allthewhile upholding“thereasoning”ofDouglas County and Drakes Bay Oyster.
ItappearsthatonlyintheNinthCircuitandonlyinDrakesBayOysteristhereanactual holdingthatthe“restoration”ofa“naturalsetting,”involvingachangeinthephysicalenvironment, neednottriggerNEPAreview.DrakesBayOyster isaninnovativeexpansionofDouglasCounty,whichhadheldthatdesignationofcriticalhabitat undertheEndangeredSpeciesActdoesnottrigger NEPAreviewbecausedesignationdoesnoteffect anychangeinthephysicalenvironment. Douglas
County,supra,48F.3dat1505.Asseenabove, thatholdingcreatedasplit,notablywiththeTenth Circuit in Caltron County, supra, 75 F.3dat 1436.
Now,theNinthCircuitappearstohavebacked awayfromthesplit,awayfromtheDouglas CountypositionregardingtheinapplicabilityofNEPAto ESA habitat designations.
With San Luis & Delta-Mendota Water
Authority v. Jewell ,
F.3d
(9th Cir –
3/13/2014).[PACERref:NinthCircuitCase11- 15871;DktEntry:118-1;Pages1-173]5,aNinthCircuitpanelhasessentiallydistinguishedDouglas CountyintoirrelevancewheretheESAis concerned.ItappearstohavetacitlyacceptedmanyofthecriticismsofDouglasofferedinCaltron Countyandelsewhere,thusattenuatingthesplit betweenCircuits,atleastregardingNEPAreview ofESAhabitatdesignation.Ibid.at[PACERat146-150].
Demonstratingthemajority’smovementawayfromthesplit,thedissentinSanLuis&Delta- MendotawouldapplyDouglas County’snowlargelysupersededESArule.Ibid.at[PACERat167-168].
However,themajorityinSanLuis&Delta- MendotadoesnotcleanlyoverruleDouglasCounty: Itisnotsittingenbanc.Instead,themajorityaffirmsthevalidityofDouglasCounty’s“reasoning,”allthewhilevitiatingitsprincipalpracticalresult.Itisaskillfulholdingthatminimizesthelikelihoodofsuccessfulenbancor
5:PetitionsforrehearingenbanchavebeenfiledandthecourthasinvitedoppositiontobefiledbyJune16,2014.NEPAdoesnotappeartobeatissueinthepetitions.
certiorarichallenge,atleastongroundsrelatingto the ESA.
Butinanapparentneedtodemonstratethatit wasnotoverrulingDouglasCounty,thepaneldid offerasacrificiallamb,trussedforslaughter, throughareaffirmationofDrakesBayOyster.The SanLuis&Delta-Mendotamajoritydistinguishes themodestfamilyoysterfarmfromthemassive California Delta water project:
Whatevereffectsimplementingthe[studies oftheimpactoftheprojectonthe endangereddeltasmelt]mighthaveonthe humanenvironment,itisapparentthatthey aremorecomplexandwide-rangingthantheremovalofafewbuildingsinDrakesBay Oyster.
Ibid. at [PACERat 149]
Dismissingtheimpactonthe“human environment”inDrakes Bay Oysteras“theremoval ofafewbuildings”maybemerelycavalier,orit maybecallousandcruel:Thefarmingfamilyloses itsbusiness,thefarmworkerslosetheirlivelihood, theregionlosesasustainablefoodsourcethatalso happenstobeajewelinthegastronomiccrownof thegreaterSanFranciscoBayArea,andour nationalheritagelosesapreciousresource,the historic“hangingcultch”oysterracksinDrakes Estero. See40CFR1508.14, MWF.APP.13.
AproperNEPAprocess,nottruncatedasitwas here,wouldhavehelpedtheunderlyingDrakes BayOystercourtformulateanopinionthataccurately reflectedtheenvironmentalconsequencesofthe proposedaction.Itcertainlywouldhavehelpedthe court flesh out real-world costs of what it
erroneouslypresentedinitsopinionastrivial.Asitwas,theonlyadverseeffectthattheunderlyingDrakesBayOysterpanelrecognizedwas“short- termharmssuchasnoiseassociatedwithheavy machineryneededtoremoveDrakesBay’s structures.”DrakesBayOyster,supra,729F.3dat 984,P.APP.31.TheDrakesBayOystermajoritydrasticallyunderstatedtheharminflictedbythe decision
D:DrakesBayOyster’sanomalousholdingisoddenoughtosuggesthavingbeen,in somesubtleway,aresultofconfutingtheNationalEnvironmentalPolicyActwith the Wilderness Act.
AfterSanLuis&Delta-Mendota,allthatisreallyleftoftheDouglasCounty/DrakesBay Oysterlineofcasesistheisolatedholdingthata decisionto“restore”pristinewildnessdoesnot triggerNEPAreview.ThedecisioninDrakesBay Oysterhasbecomeananomaly,adangerousanomaly.Itsoddityraisesthequestion,whereon earthcouldithavecomefrom?WhydidtheDrakes BayOystermajorityputforwardsuchaneccentric holding?
Theanswermaylieinthelargercontextofthe DrakesBayOystercase,ofthePointReyes NationalSeashore,andevenoftheenvironmental movement.
Thenubwouldbedivergentviewsabouthow theSeashoreshouldbemanaged,andespecially abouttheroleofsustainableagricultureinit. Environmental purists believe that the entire
Seashoreshouldbereturnedasfaraspossibleto theconditioninwhichSirFrancisDrakefounditin 1579.Othersrememberthattherewouldbeno NationalSeashoreiftheagriculturalistshad decidedinthe1960’stoselltheirlandto commercialrealestatedevelopersratherthanto the National Park Service.
Giventhattheunderlyingcaseisembeddedin thismatrix,itisimportanttounderstandhowthe oyster farm fits into the Seashore.
TheoysterfarmisentirelywithinthePoint ReyesNationalSeashore.TheSeashorehastwo principalzones,thepastoralzoneandthe wildernesszone.Thepastoralzoneisgenerallyin thewesternpartofthePointReyesPeninsulaand includesmanydairyfarms.Mostoftherestofthe Seashore,includingalltheestuarialwaters,is designated wilderness.
Theoysterfarmhastwodistinctparts,the onshorefacilities,entirelywithinthepastoralzone, andtheoysterbeds,entirelywithindesignated wilderness.Theoysterfarm’sonshorefacilitiesare analogoustothebarns,outbuildingsand habitationsinthedairyfarms.Theoysterbedsare the equivalent to the dairy farm pastures
Theoysterbedsarebasicallyoftwotypes: Firstareoysterbedsthatsimplyrestonthe bottom,oftencoveredwithalayerofoystershells, andsecondaretheoysterbedsthatuseoyster rackstosuspendtheoystersabovethebottom. Thesearethehistoricallyinvaluable“hanging cultch” oyster racks.
TheNationalParkServicecontractedastudy of the oyster farm as an historic resource, the
NationalParkServiceNationalRegisterofHistoric PlacesRegistrationForm,March21,2011,by CaywoodandHagen,CRCS,Missoula,Montana; (“National Registerstudy”).6 TheNationalRegisterstudypresentstheoysterracksasthecentral element of the overall site’s historical significance:
[T]hesiteissignificantforitsassociation withtheintroductionofJapaneseoff-bottom growingmethods,specificallythehanging cultchmethod.Intheearly1960s,Johnson OysterCompanysuccessfullyadaptedthis methodtoconditionsintheestero,andindoingso,becameoneofthelargest commercial oyster producers in the state….
Whenconsideringonlyhistoricalsignif- icance,JohnsonOysterCompanyfacility wouldbeeligibleforlistingunderNational RegisterCriterionA….Theareaof significancewouldbeMaritimeHistory….. [T]heracksintheesteroareintheiroriginal locations,andtheproperty’ssetting—the pastorallandscapesurroundingthebay— hasbeenlittlealteredsincetheearly1930s. (Ibid., p.12)
TheNationalRegisterstudyconcludedthat thesiteasawholewasnoteligibleforlisting,but thereasonsforthenegativedeterminationdidnot involvetheoysterracks. (Ibid.,pp.12-13.) The
6:<http://www.nps.gov/pore/parkmgmt/upload/planning_dboc_sup_background_nrhp_doe_with-shpo_letter_110804.pdf>
AmicusmodelsitsreferencetoaNationalParkServiceURLonthisCourt’sreferencetoaForestServiceURLinSummersv.EarthIslandInst., 555 U.S. 488,495(2009). Counselfor Amicushasafilecopyofthedocumentin“pdf”format,downloadedonMay10,2014.
reasonshadtodowithchangesthathadbeenmade totheOnshoreFacilitiesoverrecentdecades, includingthosemadeinresponsetoupdatedpublic healthregulations.(Ibid.)Itmaybethatsomeof thereasonsderivefromasensethatthe architecture,constructionandupkeepofthis working oyster farm are a bit too vernacular.
However,thepertinentpointisthattheoyster rackswouldbeeligibleiftakenalone:An“historic property”includes“anyhistoric…structure… eligibleforinclusionintheNationalRegister.”36 CFR800.16(l)(1),MWF.APP.6.Theoysterracksareeligibleandshouldhavebeenprotectedunderthe NHPA.Iftheyhadbeen,theprocessforremoving theoysterfarmwouldhavehadtogothroughthe ACHP,whichwouldnothaveletgoofsucha precioushistoricresourceaseasilyastheSecretary of the Interior did.
Ultimately,thedecisionbytheSecretaryofthe Interiortoclosetheoysterfarmwasshapedbyhis misunderstandingoftheWildernessActof1964,mistakenlybelievingittobeonlyconsistentwith pristine wildness.7
TheDrakesBayOystermajority’ssupportfor theSecretary’spositiononpristinewildnessmay
7 :FocusingnarrowlyonthePointReyesWildernessActof1976,neitherdissentnormajorityevokedlong-standingNinthCircuitjurisprudencethatconstruestheover-archingWildernessActof1964assupportingapragmaticratherthanpuristunderstandingof“wilderness,”onethatimpliesanuancedlegalframework wherethe idealofpristine wildnesscancoexistwithawiderrangeofuseandpurpose.See,forexample,WildernessWatchv.U.S.FishandWildlifeService,629F.3d1024,1033(9thCir.2010)andHighSierraHikersv.
Blackwell,390F.3d630,646-648(9thCir.2004)
well have shaped its holding that NEPA review was notneeded“[b]ecauseremovingtheoysterfarmisa steptowardrestoringthenatural,untouched physicalenvironment.”Ibid.at984,P.APP.31(quotation marks omitted).
ButNEPAdoesnotcallfortherestorationof someidealofpristinewildness.Rather,NEPA recognizes
thecriticalimportanceofrestoringand maintainingenvironmentalqualitytothe overall welfare and development of man,
(42U.S.C.§4331(a)[P.APP.171])
and to that end seeks
tocreateandmaintainconditionsunder whichmanandnaturecanexistin productiveharmony,andfulfillthesocial, economicandotherrequirementsofpresent and future generations of Americans. (Ibid.)
Morespecifically,NEPAcallsforgovernmental action that will
attainthewidestrangeofbeneficialusesof theenvironmentwithoutdegradation…; preserveimportanthistoric,culturalandnaturalaspectsofournationalheritage,… [and]enhancethequalityofrenewable resources.
42U.S.C.§4331(b)(3),(4)&(6)[P.APP.172-
173](Emphasis supplied.)
Historicpreservationisanexplicitstatutorygoalof NEPA.“Restoration”ofpristinewildness,assuch,is not.
DrakesBayOyster’smisapplicationofNEPA isnotmerelyerroneous;itisanerrorthatcreates anintolerablesplitbetweenCircuitsandposesanimminentthreattohistoricresourcesinfederally administered wildlands.
CONCLUSION
ThePetitionforWritofCertiorarishouldbe granted.
DATED: May 15, 2014
Respectfully submitted,
JAMES TALCOTT LINFORD
Attorney for Amicus Curiae The Monte Wolfe Foundation
AMICUS MONTE WOLFE FOUNDATION APPENDIX
[“MWF.APP.”]
INDEX
Excerpts from National Historic Preservation Act of 1966(NHPA)
Sec. 106: Advisory Council on
page
Historic Preservation (ACHP) 2
Sec.211:Regulations for Sec. 106 2
Excerpts from “Protection of Historic Properties” regulations implementing Sec. 106,
36 CFR Part 800
page
§ 800.3Initiation of the section 106 process 3
- 800.4 Identification of historic properties 3
- 800.8: Coordination with the NEPA 5
APPENDIXATOPART800 7
ExcerptsfromCouncilonEnvironmentalQuality (CEQ) regulations:40 CFR 1500-1508
page
§ 1508.4“Categorical Exclusion”(CE) 11
§ 1508.8“Effects” 11
§ 1508.9“Environmental assessment” (EA) 12
§ 1508.11“Env’l impact statement” (EIS) 12
§ 1508.13“Finding of no significant impact” 13
§ 1508.14“Human environment” 13
§ 1508.27“Significantly” 13
Excerpts from
National Historic Preservation Act of 1966
Section106[16U.S.C.470f—AdvisoryCouncil onHistoricPreservation,commentonFederal undertakings]
TheheadofanyFederalagencyhavingdirector indirectjurisdictionoveraproposedFederalor federallyassistedundertakinginanyStateand theheadofanyFederaldepartmentor independentagencyhavingauthoritytolicense anyundertakingshall,priortotheapprovalof theexpenditureofanyFederalfundsonthe undertakingorpriortotheissuanceofany license,asthecasemaybe,takeintoaccountthe effectoftheundertakingonanydistrict,site, building,structure,orobjectthatisincludedin oreligibleforinclusionintheNationalRegister. TheheadofanysuchFederalagencyshallafford theAdvisoryCouncilonHistoricPreservation establishedunderTitleIIofthisActa reasonableopportunitytocommentwithregard to such undertaking.
Section211[16U.S.C.470s—Regulationsfor Section 106 . . ..]
TheCouncilisauthorizedtopromulgatesuch rulesandregulationsasitdeemsnecessaryto governtheimplementationofsection106ofthis Act in its entirety . . ..
Excerpts from “Protection of Historic Properties”
regulations implementing Section 106 36 CFR Part 800
§ 800.3 Initiation of the section 106 process.
(a) Establishundertaking. Theagencyofficialshall determinewhethertheproposedFederalactionis anundertakingasdefinedin§800.16(y)and,ifso, whetheritisatypeofactivitythathasthe potential to cause effects on historic properties.
(1) Nopotentialtocauseeffects. Iftheundertaking isatypeofactivitythatdoesnothavethepotential tocauseeffectsonhistoricproperties,assuming suchhistoricpropertieswerepresent,theagency officialhasnofurtherobligationsundersection106 or this part.
* * * * * *
800.4 Identification of historic properties
* * * * * *
(c) Evaluate historic significance—
(1) ApplyNationalRegistercriteria. Inconsultation withtheSHPO/THPOandanyIndiantribeor NativeHawaiianorganizationthatattaches religiousandculturalsignificancetoidentified propertiesandguidedbytheSecretary’sstandards andguidelinesforevaluation,theagencyofficial shallapplytheNationalRegistercriteria(36CFR part63)topropertiesidentifiedwithintheareaof potentialeffectsthathavenotbeenpreviously evaluated for National Register eligibility. The
passageoftime,changingperceptionsof significance,orincompletepriorevaluationsmay requiretheagencyofficialtoreevaluateproperties previouslydeterminedeligibleorineligible.The agencyofficialshallacknowledgethatIndiantribes andNativeHawaiianorganizationspossessspecialexpertiseinassessingtheeligibilityofhistoric propertiesthatmaypossessreligiousandcultural significance to them.
(2) Determinewhetherapropertyiseligible. Ifthe agencyofficialdeterminesanyoftheNational RegistercriteriaaremetandtheSHPO/THPO agrees,thepropertyshallbeconsideredeligiblefor theNationalRegisterforsection106purposes.If theagencyofficialdeterminesthecriteriaarenot metandtheSHPO/THPOagrees,theproperty shallbeconsiderednoteligible.IftheagencyofficialandtheSHPO/THPOdonotagree,orifthe CouncilortheSecretarysorequest,theagency officialshallobtainadeterminationofeligibility fromtheSecretarypursuantto36CFRpart63.If anIndiantribeorNativeHawaiianorganizationthatattachesreligiousandculturalsignificanceto apropertyofftriballandsdoesnotagree,itmay asktheCounciltorequesttheagencyofficialto obtain a determination of eligibility.
(d) Results of identificationand evaluation—
(1) Nohistoricpropertiesaffected. Iftheagencyofficialfindsthateithertherearenohistoric propertiespresentortherearehistoricproperties presentbuttheundertakingwillhavenoeffect upon them as defined in §800.16(i), the agency
officialshallprovidedocumentationofthisfinding, assetforthin§800.11(d),totheSHPO/THPO.Theagencyofficialshallnotifyallconsultingparties, includingIndiantribesandNativeHawaiian organizations,andmakethedocumentation availableforpublicinspectionpriortoapproving the undertaking.
* * * * * *
§ 800.8 Coordination With NEPA.
* * * * * *
3) Inclusionofhistoricpreservationissues. Agency officialsshouldensurethatpreparationofan environmentalassessment(EA)andfindingofno significantimpact(FONSI)oranEISandrecordof decision(ROD)includesappropriatescoping, identificationofhistoricproperties,assessmentof effectsuponthem,andconsultationleadingto resolution of any adverse effects.
(b)Actionscategoricallyexcludedunder NEPA. Ifaproject,activityorprogramiscategoricallyexcludedfromNEPAreviewunderan agency’sNEPAprocedures,theagencyofficialshall determineifitstillqualifiesasanundertaking requiringreviewundersection106pursuantto§ 800.3(a).Ifso,theagencyofficialshallproceedwith section106reviewinaccordancewiththe procedures in this subpart.
* * * * * *
§ 800.16 Definitions.
* * * * * *
(g) CouncilmeanstheAdvisoryCouncilon HistoricPreservationoraCouncilmemberor employee designated to act for the Council.
* * * * * *
(i) Effectmeansalterationtothecharacteristicsof ahistoricpropertyqualifyingitforinclusioninor eligibility for the National Register.
(j) Foreclosuremeansanactiontakenbyanagency officialthateffectivelyprecludestheCouncilfrom providingcommentswhichtheagencyofficialcan meaningfullyconsiderpriortotheapprovalofthe undertaking.
* * * * * *
(l)(1)Historicpropertymeansanyprehistoricor historicdistrict,site,building,structure,orobject includedin,oreligibleforinclusionin,theNational RegisterofHistoricPlacesmaintainedbythe SecretaryoftheInterior.Thistermincludes artifacts,records,andremainsthatarerelatedto andlocatedwithinsuchproperties.Theterm includespropertiesoftraditionalreligiousand culturalimportancetoanIndiantribeorNative HawaiianorganizationandthatmeettheNational Register criteria.
(2) ThetermeligibleforinclusionintheNational Registerincludesbothpropertiesformally determinedassuchinaccordancewithregulations oftheSecretaryoftheInteriorandallother properties that meet the National Register criteria.
* * * * * *
(q) NationalRegistermeanstheNationalRegister ofHistoricPlacesmaintainedbytheSecretaryof the Interior.
(r) NationalRegistercriteriameansthecriteria establishedbytheSecretaryoftheInteriorforuse inevaluatingtheeligibilityofpropertiesforthe National Register (36 CFR part 60).
* * * * * *
(y) Undertakingmeansaproject,activity,or programfundedinwholeorinpartunderthe directorindirectjurisdictionofaFederalagency, including those carried out by or on behalf of a Federalagency;thosecarriedoutwithFederal financialassistance;andthoserequiringaFederal permit, license or approval.
APPENDIXATOPART800—CRITERIAFORCOUNCILINVOLVEMENTINREVIEWINGINDIVIDUALSECTION106CASES
(a) Introduction.Thisappendixsetsforththe criteriathatwillbeusedbytheCouncilto determinewhethertoenteranindividualsection 106reviewthatitnormallywouldnotbeinvolved in.
(b) Generalpolicy.TheCouncilmaychooseto exerciseitsauthoritiesunderthesection106 regulationstoparticipateinanindividualproject pursuanttothefollowingcriteria.However,the Councilwillnotalwayselecttoparticipateeven though one or more of the criteria may be met.
(c) Specificcriteria.TheCouncilislikelytoenter thesection106processatthestepsspecifiedinthe regulations in this part when an undertaking:
(1) Hassubstantialimpactsonimportanthistoric properties.Thismayincludeadverseeffectson propertiesthatpossessanationallevelof significanceoronpropertiesthatareofunusualor noteworthyimportanceorareararepropertytype; oradverseeffectstolargenumbersofhistoric properties,suchasimpactstomultipleproperties within a historic district.
(2) Presentsimportantquestionsofpolicyor interpretation.Thismayincludequestionsabout howtheCouncil’sregulationsarebeingappliedor interpreted,includingpossibleforeclosureor anticipatory demolition situations; situations where theoutcomewillsetaprecedentaffectingCouncil policiesorprogramgoals;orthedevelopmentof programmaticagreementsthatalterthewaythe section106processisappliedtoagrouportypeof undertakings.
(3) Hasthepotentialforpresentingprocedural problems.Thismayincludecaseswithsubstantial publiccontroversythatisrelatedtohistoric preservationissues;withdisputesamongorabout consultingpartieswhichtheCouncil’sinvolvement couldhelpresolve;thatareinvolvedorlikelytobe involvedinlitigationonthebasisofsection106;or carriedoutbyaFederalagency,inaStateor locality,orontriballandswheretheCouncilhas previouslyidentifiedproblemswithsection106 compliance pursuant to §800.9(d)(2).
(4) PresentsissuesofconcerntoIndiantribesor NativeHawaiianorganizations.Thismayinclude caseswheretherehavebeenconcernsraisedabout theidentificationof,evaluationoforassessmentof effectsonhistoricpropertiestowhichanIndian tribeorNativeHawaiianorganizationattaches religiousandculturalsignificance;whereanIndian tribeorNativeHawaiianorganizationhas requestedCouncilinvolvementtoassistinthe resolutionofadverseeffects;orwherethereare questionsrelatingtopolicy,interpretationor precedentundersection106oritsrelationtoother authorities,suchastheNativeAmericanGraves Protection and Repatriation Act.
Excerpts from
Council on Environmental Quality (CEQ) regulations: 40 CFR 1500-1508
§ 1507.3 Agency procedures.
(a) Notlaterthaneightmonthsafterpublication oftheseregulationsasfinallyadoptedinthe FederalRegister,orfivemonthsafterthe establishmentofanagency,whichevershall comelater,eachagencyshallasnecessaryadopt procedurestosupplementtheseregulations. Whentheagencyisadepartment,major subunitsareencouraged(withtheconsentofthe department)toadopttheirownprocedures.Such proceduresshallnotparaphrasethese regulations.Theyshallconfinethemselvesto implementingprocedures.Eachagencyshall consult with the Council while developing its
proceduresandbeforepublishingtheminthe FederalRegisterforcomment.Agencieswith similarprogramsshouldconsultwitheachother andtheCounciltocoordinatetheirprocedures, especiallyforprogramsrequestingsimilar informationfromapplicants.Theprocedures shallbeadoptedonlyafteranopportunityfor publicreviewandafterreviewbytheCouncilfor conformitywiththeActandtheseregulations. TheCouncilshallcompleteitsreviewwithin30 days.Onceineffecttheyshallbefiledwiththe Councilandmadereadilyavailabletothepublic. Agenciesareencouragedtopublishexplanatory guidancefortheseregulationsandtheirown procedures.Agenciesshallcontinuetoreview theirpoliciesandproceduresandinconsultation withtheCounciltorevisethemasnecessaryto ensurefullcompliancewiththepurposesand provisions of the Act.
(b) Agencyproceduresshallcomplywiththese regulationsexceptwherecompliancewouldbe inconsistentwithstatutoryrequirementsand shall include:
- ThoseproceduresrequiredbySecs. 1501.2(d),1502.9(c)(3),1505.1,1506.6(e), and 1508.4.
- Specificcriteriaforandidentificationof those typical classes of action:
(i) Whichnormallydorequireenviron- mental impact statements.
(ii) Whichnormallydonotrequireeitheran environmentalimpactstatementoran environmentalassessment(categorical exclusions (Sec. 1508.4)).
(iii) Whichnormallyrequireenvironmental assessmentsbutnotnecessarily environmental impact statements.
* * * * * *
§ 1508.4 Categorical exclusion.
Categoricalexclusionmeansacategoryofactions whichdonotindividuallyorcumulativelyhavea significanteffectonthehumanenvironmentand whichhavebeenfoundtohavenosucheffectin proceduresadoptedbyaFederalagencyin implementationoftheseregulations(§1507.3)andforwhich,therefore,neitheran environmentalassessmentnoranenvironmental impactstatementisrequired.Anagencymay decideinitsproceduresorotherwise,toprepare environmentalassessmentsforthereasons statedin§1508.9eventhoughitisnotrequired todoso.Anyproceduresunderthissectionshall provideforextraordinarycircumstancesinwhich anormallyexcludedactionmayhavea significant environmental effect.
§ 1508.8 Effects. Effectsinclude:
(a) Directeffects,whicharecausedbytheaction and occur at the same time and place.
(b) Indirecteffects,whicharecausedbythe actionandarelaterintimeorfartherremoved indistance,butarestillreasonablyforeseeable. Indirecteffectsmayincludegrowthinducing effectsandothereffectsrelatedtoinduced changesinthepatternoflanduse,population densityorgrowthrate,andrelatedeffectsonair andwaterandothernaturalsystems,including ecosystems.
Effectsandimpactsasusedintheseregulations aresynonymous.Effectsincludesecological(such astheeffectsonnaturalresourcesandonthe components,structures,andfunctioningofaffected ecosystems),aesthetic,historic,cultural,economic, social,orhealth,whetherdirect,indirect,or cumulative.Effectsmayalsoinclude those resultingfromactionswhichmayhaveboth beneficialanddetrimentaleffects,evenifon balancetheagencybelievesthattheeffectwillbe beneficial.
§ 1508.9 Environmental assessment.
Environmental assessment:
(a) Meansaconcisepublicdocumentforwhicha Federal agency is responsible that serves to:
(1) Brieflyprovidesufficientevidenceandanalysis fordeterminingwhethertopreparean environmentalimpactstatementorafindingofno significant impact.
(2) Aidanagency’scompliancewiththeActwhen no environmental impact statement is necessary.
(3) Facilitatepreparationofastatementwhenone is necessary.
(b) Shallincludebriefdiscussionsoftheneedfor theproposal,ofalternativesasrequiredbysection 102(2)(E),oftheenvironmentalimpactsofthe proposedactionandalternatives,andalistingof agencies and persons consulted.
§ 1508.11 Environmental impact statement. Environmentalimpactstatementmeansadetailed written statement as required by §102(2)(C) of Act.
§ 1508.13 Finding of no significant impact.
Findingofnosignificantimpactmeansadocument byaFederalagencybrieflypresentingthe reasonswhyanaction,nototherwiseexcluded (§1508.4),willnothaveasignificanteffectonthehumanenvironmentandforwhichan environmental impact statement therefore will notbeprepared.Itshallincludethe environmentalassessmentorasummaryofit andshallnoteanyotherenvironmental documentsrelatedtoit(§1501.7(a)(5)).Iftheassessmentisincluded,thefindingneednot repeatanyofthediscussionintheassessment but may incorporate it by reference.
§ 1508.14 Human environment.
Humanenvironmentshall be interpreted compre- hensivelytoincludethenaturalandphysical environmentandtherelationshipofpeoplewith thatenvironment.(Seethedefinitionof“effects” (§1508.8).)Thismeansthateconomicorsocialeffectsarenotintendedbythemselvestorequire preparationofanenvironmentalimpactstatement.Whenanenvironmentalimpact statement is prepared and economic or social and naturalorphysicalenvironmentaleffectsare interrelated,thentheenvironmentalimpact statementwilldiscussalloftheseeffectsonthe human environment.
§ 1508.27 Significantly.
SignificantlyasusedinNEPArequiresconsider- ations of both context and intensity:
(a) Context. Thismeansthatthesignificanceof anactionmustbeanalyzedinseveralcontexts suchassocietyasawhole(human,national),the affectedregion,theaffectedinterests,andthe locality.Significancevarieswiththesettingof the proposed action. For instance, in the case of a site-specificaction,significancewouldusually dependupontheeffectsinthelocaleratherthan intheworldasawhole.Bothshort-andlong-term effects are relevant.
(b) Intensity. Thisreferstotheseverityofimpact.Responsibleofficialsmustbearinmind thatmorethanoneagencymaymakedecisions aboutpartialaspectsofamajoraction.The followingshouldbeconsideredinevaluating intensity:
(1) Impactsthatmaybebothbeneficialand adverse.Asignificanteffectmayexistevenif theFederalagencybelievesthatonbalancethe effect will be beneficial.
(2) Thedegreetowhichtheproposedaction affects public health or safety.
(3) Uniquecharacteristicsofthegeographic areasuchasproximitytohistoricorcultural resources,parklands,primefarmlands, wetlands,wildandscenicrivers,orecologically critical areas.
(4) Thedegreetowhichtheeffectsonthe qualityofthehumanenvironmentarelikelyto be highly controversial.
(5) Thedegreetowhichthepossibleeffectson thehumanenvironmentarehighlyuncertain or involve unique or unknown risks.
(6) Thedegreetowhichtheactionmayestablishaprecedentforfutureactionswith significanteffectsorrepresentsadecisionin principle about a future consideration.
(7) Whethertheactionisrelatedtoother actionswithindividuallyinsignificantbut cumulativelysignificantimpacts.Significance existsifitisreasonabletoanticipatea cumulativelysignificantimpactonthe environment.Significancecannotbeavoidedby terminganactiontemporaryorbybreakingit down into small component parts.
(8) Thedegreetowhichtheactionmay adverselyaffectdistricts,sites,highways, structures,orobjectslistedinoreligiblefor listingintheNationalRegisterofHistoric Placesormaycauselossordestructionof significantscientific,cultural,orhistorical resources.
(9) Thedegreetowhichtheactionmay adverselyaffectanendangeredorthreatened speciesoritshabitatthathasbeendetermined tobecriticalundertheEndangeredSpeciesAct of 1973.
(10) Whethertheactionthreatensaviolationof Federal,State,orlocallaworrequirements imposed for the protection of the environment.
Posted by Jane Gyorgy on May 19, 2014
https://oysterzone.wordpress.com/2014/05/19/05-19-2014-monte-wolfe-foundation-amicus-curiae-brief/
05-19-2014 Goodman Houser AMICI CURIAE Brief
(Unfortunately, Adobe PDF file converter has a tendency to run words together
so I am providing access both through the link below as well as by scrolling down to read the ‘converted file.)
05-19-2014 Goodman Houser DBOC brief
No. 13-1244
————————————————————————
In the Supreme Court of theUnited States
——————
DRAKES BAY OYSTER COMPANY AND KEVIN LUNNY,
Petitioners,
SALLY JEWELL, SECRETARY OF THE UNITED STATES DEPARTMENT OF THE INTERIOR; ETAL.,
——————
On Petition For WritOf Certiorari To The UnitedStates Court Of Appeals For The Ninth Circuit
——————
BRIEF OF DR. COREY S. GOODMAN AND DR.PAUL R.HOUSER
AS AMICI CURIAE
SUPPORTING PETITIONERS AND REVERSAL
PETERS.PROWS
Counsel of Record JOHN BRISCOE LAWRENCE S.BAZEL BRISCOE IVESTER &
BAZEL LLP
155 Sansome Street
Seventh Floor
San Francisco, CA 94104(415) 402-2700
CounselFor Amici Curiae
TABLE OFCONTENTS
INTEREST OF AMICI CURIAE…………………………. 1
SUMMARY OF ARGUMENT:SCIENTIFIC INTEGRITY IS
CENTRAL TO OUR DEMOCRACY…………… 6
ARGUMENT………………………………………………….. 8
- SCIENTIFIC MISCONDUCT UNDERMINES OUR DEMOCRACY:
THREE EXAMPLES……………………………….. 8
- Drakes Bay Oyster Company………….. 8
- KlamathRiver DamsRemoval……….. 13
- Department of Justice………………….. 16
- THERE ISA LACK OF ACCOUNTABILITY FOR SCIENTIFIC
MISCONDUCT IN GOVERNMENT………… 17
- Need For Scientific Integrity
Policy BecomesApparent………………. 17
- The Rocky Development And Implementation Of The President’s Scientific Integrity
Policy…………………………………………. 19
- COURTS HAVE AN IMPORTANT ROLE IN ENSURING SCIENTIFIC
INTEGRITY IN GOVERNMENT…………….. 22
CONCLUSION……………………………………………… 26
Cases
TABLE OF AUTHORITIES
Daubertv.Merrell Dow Pharms.,
509 U.S. 579 (1993)……………………………….7, 22, 23
General Electric,Inc.v. Joiner,
522 U.S. 136 (1997)……………………………………. 25
San Luis & Delta-MendotaWater Auth. v.
Salazar,
(E.D. Cal. no. 1:09-cv-00407)………………………23,24
United States v. Olsen,
737 F.3d 625 (9th Cir.2013)…………………16, 17, 21
Statutes and Other Authorities
33 U.S.C.§1251(a)(2)………………………………………. 9
Fed. R. Evid. R. 702……………………………………….. 22
P.L. 106-554 § 515, 114 Stat. 2763A-153-154
(December 21,2000)…………………………………… 20
Delta Smelt Cases,Bench Rulingon Motion toStay Pending Appeal (Sept. 16, 2011), dkt. no.1056, availableat http://plf.typepad.com/
files/9-16-11-motion-to-stay-final-1.pdf………………… 23
Department of Justice, Scientific and ResearchIntegrityPolicy, at 1,available athttp://www.justice.gov/open/doj-scientific-
integrity-policy.pdf…………………………………….. 21
Department of theInterior, Integrity ofScientific and Scholarly Activities (January28, 2011),available at http://elips.doi.gov/
elips/0/ doc/3045/Page1.aspx………………………… 10
Emily Yehle, “Rushed USGSReport OnOysterFarm Misrepresented Biologist’sFindings”,Greenwire(May 14, 2013), availableathttp://www.eenews.net/greenwire/
stories/1059981143……………………………………… 20
“In Private Letter, Tim Ragen Admits NoEvidenceFor Seal Study”,Point Reyes Light(August 9, 2012), available at http://www.ptreyeslight.com/article/private-letter-tim-
ragen-admits-no-evidence-seal-study…………….. 13
John Bowman,“Secretary Of InteriorAnnouncesResignation”, Taft MidwayDriller(Jan. 17, 2013), availableat http://www.taftmidwaydriller.com/article/20130117/NEW
S/130119808/0/FRONTPAGE……………………….. 14
John P. Holdren, Director, Officeof Science andTechnology Policy,Memorandum on Scientific Integrity, (December 17, 2010),available at http://www.whitehouse.gov/sites/default/files/microsites/ostp/scientific-
integrity-memo-12172010.pdf………………………. 19
Letter from Dr. Paul Houser, Scientific IntegrityOfficer, Bureauof Reclamation, to theDepartment of theInterior, Allegation OfScientific And Scholarly Misconduct AndReprisal For A Disclosure ConcerningTheBiased Summarization Of Key ScientificConclusionsFor The Klamath River DamRemoval Secretarial Determination Process(February 24, 2012), available athttp://www.peer.org/assets/docs/doi/8_8_12_H
ouser_sci_integ_complaint.pdf…………………. 14-15
Letter from JonathanB. Jarvis,Director,National Park Service, to Amber D. Abbasi,counsel for Dr. Goodman(Dec. 21, 2012),available athttp://causeofaction.org/assets/uploads/2013/03/FINAL-Report_Exhibits.pdf
at Exhibit 51 (page 1003)…………………………….. 20
Marine Mammal Commission,Mariculture AndHarbor Seals In Drakes Estero,California at
27 (November 22, 2011)………………………………. 12
National Academy of Sciences, ResponsibleScience: Ensuringthe Integrityof theResearchProcess at 27 (1992),availableat
http://nap.edu/catalog.php?record_id=1864.…………. 18
National ResearchCouncil, EndangeredAndThreatenedFishes In The Klamath RiverBasin: Causes Of Decline And Strategies ForRecovery at 5-6 (2004), availableat http://
www.nap.edu/catalog.php?record_id=10838…………. 13
Presidential Memorandum on Scientific Integrity (March 9, 2009), availableat http://www.whitehouse.gov/the-press-office/memorandum-heads-executive-departments-
and-agencies-3-9-09……………………………………. 19
RemarksBy The President At The NationalAcademy Of Sciences Annual Meeting(April28, 2009),available at http://www.whitehouse. gov/the_press_office/Remarks-by-the-President-at-the-National-Academy-of-
Sciences-Annual-Meeting………………………………. 6
RESOLVE,IndependentEvaluationOf TheScientific Record Pertaining To TheAllegations Of Dr. Paul Houser(August 2012)available at http://www.doi.gov/scientificintegrity/upload/DOI-SI-Case-313-
Independent-Report.pdf………………………………. 15
U.S. House of Representatives,Committee onNatural Resources,Officeof Oversight andInvestigations:Holding InteriorWatchdogAccountable, 59-66 (February 21, 2013),available at http://naturalresources.house.gov/uploadedfiles/oversightreportdepartment
ofinterior.pdf…………………………………………….. 15
William Broad and NicholasWade, Betrayers OfThe Truth: Fraud And Deceit In The Halls Of
Science(1982)……………………………………………. 18
INTERESTOFAMICICURIAE1
- CoreyS.Goodman
- CoreyS.Goodman’sinterestinthiscasedatesbacktoApril28,2007whenMarinCountySupervisor Steve Kinsey (then President of the BoardofSupervisors,andtodayChairoftheCalifornia CoastalCommission)contactedDr.Goodman,baseduponhisscientificcredentialsandexperienceinscienceandpublicpolicy,andaskedhimtoanalyzetheNationalParkServicescienceconcerningDrakesEstero.SupervisorKinseyinvitedDr.GoodmantotestifyasanindependentscientistattheMay 8,2007CountyhearingastowhetherPark ServicedatasupportedParkServiceclaims.Atthetime,Dr.GoodmandidnotknowKevinLunny,ownerofDrakesBayOysterCompany.Dr.GoodmantestifiedthatParkServiceofficialsmisrepresentedtheirown dataineverycategoryofenvironmentalharm.HisanalysisshowedParkServicedatadidnotsupportPark Serviceclaims.
- Goodman’sknowledgeofthescience involvingtheoysterfarmledhimtowritenumerousreportstoFederal,State,andCountyagenciesandcommittees,toworkwithelectedofficialsatalllevelsofgovernment,andtopublishnumerousarticles/op-edsinlocalmediaabouttheoysterfarmcontroversy
1 Counselforpetitionersis alsocounselforamiciDr.GoodmanandDr.Houser,and,withtheassistanceofamici,preparedthisbriefinitsentirely.Allhardcostsarebeingpaidbyamici,andcounsel’stimehasbeengivenprobono.Amicigavetimelynoticetoallpartiesoftheirintenttofilethisbrief.Allpartiesgavetheirconsenttothisfiling,andthoseconsentsarebeingsubmittedwiththisbrief.
withafocusonthemisrepresentationofsciencebyNPSandtheirsupporters,andthelackofevidenceshowingenvironmentalharmbytheoysterfarm.Dr.Goodmanalsofiledanamicusbriefinsupportoftheoysterfarm’spetitionforrehearingenbancwiththeNinthCircuitCourtofAppeals.Hisfocushascontinuedtobeontheimportanceofscientificintegrity in guiding policy decisions.
- GoodmanwasProfessorofBiologyatStanfordUniversityandEvanRauchChairofNeurobiologyatUniversityofCaliforniaBerkeleyfortwenty-fiveyearsbeforeretiringandmovingintotheprivatesectorwhereheisManagingPartnerofvenBioPartnersLLC,alifesciencesventurecapitalfirm.Dr.GoodmanremainsAdjunctProfessorof AnatomyandBiochemistry&BiophysicsattheUniversityofCaliforniaSanFrancisco.Hehaspublishedover200peer-reviewedscientificpapers.HeisanelectedmemberoftheNationalAcademyofSciences,AmericanAcademyofArtsandSciences,andAmericanPhilosophicalSociety,andrecipientofmany honorsincludingtheAlanT.WatermanAward,CanadaGairdnerBiomedicalAward,March-of-DimesPrizeinDevelopmentalBiology,Reeve-IrvineResearchMedal,andDawsonPrizein Genetics.
Sinceretiringfromhisacademiccareer,Dr.Goodmanhasworkedintheprivatesector,firstasPresidentandCEOofabiotechnologycompanyheco-founded,tookpublic,and thensoldtoalargercompany,thenasPresidentofPfizer’sBiotherapeuticsandBioinnovationCenterandamemberofPfizer’sexecutiveleadershipteam,and todayasmanagingpartnerofaventurecapitalfirmheco-foundedandChairofsixbiotechnologycompanies. Inthesecapacities, hehasoverseentech-
nologyinnovationsfornewtherapeuticapproachestohumandisease,anddrugdiscoveryanddevelopmentprogramsindiverseareasincludingneurologicaldisease,pain,cancer,metabolicdisease,immunedisease, and cardio-vascular disease.
Amongsthispublicpolicyroles,Dr.GoodmanistodayChairoftheCaliforniaCouncilonScienceandTechnology(advisingtheGovernorandStateLegislature)andisformerChairoftheNationalResearchCouncil’sBoardonLifeSciences(advisingtheFederalGovernment).Inthesecapacities,hehas overseenarangeofstudiesandreportstotheFederalandCaliforniaGovernmentontopicsincludingstemcells,humancloning,waterborne pathogens,thenation’senvironmentalchallenges,reorganizationoftheNationalInstitutesofHealth,hydraulicfracking, and water policy management.
- Goodman’sanalysisofthedatabehindtheParkService’sclaimsabouttheoysterfarmhasallbeen done pro bono as a public service.
- PaulR.Houser’sinterestinthiscase focusesonitsscientificintegrityandethicalissues. Dr.Houseriskeenlyinterestedintheissueofscientificintegrity,andhaspursuedinitiativestorestore public trust in government science.
- Houserisaninternationallyrecognizedexpertinsurface-atmosphericremotesensing,in-situobservation,numericalsimulation,hydrologicdataassimilation,scientificintegrityandpolicy, andglobalwaterandenergycycling.Hiscareerbeganin1988exploringsurfacewaterqualityissuesintheYakimaRiverBasin(WashingtonState)attheU.S.Geological Survey, followed by thedevelopmentoflandfill cover technology at Los Alamos National
Dr.PaulR.Houser
Laboratoryin1991.In1997,Dr.HouserjoinedtheNASA-GSFCHydrologicalSciencesBranchandtheDataAssimilationOffice,servedasmanagerofNASA’sLandSurfaceHydrologyProgramfrom1999-2000,andservedasbranchheadoftheHydrologicalScienceBranchfrom2000-2005.In2005,Dr.HouserjoinedtheGeorgeMasonUniversityClimateDynamicsProgramandtheGeographyandGeo-informationSciencesDepartmentasProfessorofGlobalHydrology,andformedtheCenterforResearchforEnvironmentandWaterwiththe missiontoquantifyandpredictwatercycleandenvironmentalconsequencesofearthsystemvari-ability and change.
- Houserhaslednumerousscientificcontributions,includingthedevelopmentofLandDataAssimilationSystems,theHydrosphericStatesMission, theLand InformationSystem, theNASAEnergyandWatercycleStudy,andtheWaterCycleSolutionsNetwork(WaterNet).Hehaspublishedover120peer-reviewpublications.In2000,Dr.HouserwonthePresidentialEarlyCareerAwardforScientistsandEngineers(PECASE),andin2005hewon the NASA Softwareof theYear Award.
In2011-2012,Dr.Houserserved asScience AdvisortotheU.S.BureauofReclamation,wherehe wasresponsiblefordevelopingscientificintegrity,peerreview,anddatastewardshippolicies,aswellascoordinatingReclamationactivitieswithotheragenciesandthescientificcommunity.Afterraisingconcernsaboutthescientificintegrityofbiased sciencereportingconcerningtheproposedKlamathdamremovals,Dr.HouserwasfiredfromReclamation.HeraisedhisconcernstotheOfficeofSpecialCouncilinaformalwhistleblowercase,andwith the Department of the Interior in a formal
scientificintegrityallegation.The whistleblowercasewassettledwithafavorableoutcome,andthescientificintegritycasewasdismissedlargelybecauseanindependentreviewfoundthatbiasin science-basedpressreleaseswasstandardbusinesspracticeattheDepartmentoftheInterior.Dr.HouserhadnofiduciarytiesorconflictsassociatedwiththeKlamathRiverdecisionprocess.Heisnotfororagainstdamremoval,butratherisforthebestscienceinformingpolicydecisionsthatobeythelaw,protect the environment and advance society.
- HouserhasauniqueperspectiveontheDepartmentoftheInterior’sScientificIntegrityPolicybecausehe:(i)servedontheteamthatwrote Interior’sScientificIntegrityPolicy;(ii)servedasReclamation’sScientificIntegrityOfficerwhere heprocessedscientificintegrityallegations(e.g.,JudgeWanger’sSeptember2011allegationsonDelta-Smeltissues);and(iii)wasthesubjectofwhistleblowerretaliationrelatedtohisscientificintegrityconcernswiththeKlamathDamremoval.HehasusedhisuniqueexperiencetoofferacritiqueofDOI’sScientificIntegrityPolicy(August2012)whichispartiallyreportedin this brief.
- Houserhashadnoinvolvementin decisionsaboutDrakesBayOysterCompany,andisnotadvisingthecompanyinitslitigationagainsttheDepartment of the Interior.
SUMMARYOF ARGUMENT:SCIENTIFICINTEGRITYIS CENTRAL TO
OUR DEMOCRACY
TheEinsteinMemorialoutsidetheNationalAcademyofSciencesbuildinginWashingtonD.C.isinscribedwithaquotationfromAlbertEinstein:“Therighttosearchfortruthimpliesalsoaduty;onemustnotconcealanypartofwhatonehasrecognizedto be true.”
Inthesamevein,PresidentObamareceivedastandingovationfromthecountry’stopscientistsattheNationalAcademyofSciencesannualmeetingin2009whenhesaid:“thedaysofsciencetakingabackseattoideologyareover.Ourprogressasanation–andourvaluesasanation–arerootedinfreeandopeninquiry.Tounderminescientificintegrityis to undermine our democracy.”2
Nowherearetheseprinciplesmoreimportantthaningovernment decision-making. WhenCongresspasseslaws,agenciesmakedecisions,andcourtshanddownrulings,people’slivesandlivelihoods—andtheenvironmentalfutureofourplanet—areontheline.Ensuringthatdecisionsusethe best science is central to good government.
Buttoooften,asthisbriefexplains,scientificmisconduct—definedasfabrication,falsification,plagiarism,orretaliation—isusedtosupportgovernmentdecisions. Thegovernmentdecisionat
2 RemarksByThePresidentAtTheNationalAcademyOfSciencesAnnualMeeting(April28,2009),availableathttp://www.whitehouse.gov/the_press_office/Remarks-by-the-President-at-the-National-Academy-of-Sciences-Annual-Meeting.
issueinthiscasewasthedenialofanewpermittoahistoricoysterfarminCalifornia.Thatdecisionwasbasedinpartonanenvironmentalanalysisthatfalselyclaimedtofindasignificantadverseimpact,eventhoughtheagency’sownanalysisofthedata,confirmedbytheagency’soutsideexpert,found“no evidence”ofanyimpact.Thefalseclaimofharmfollowedayears-longpatternofotherfalse,andnowretracted,claimsbytheParkServicethattheoyster farmcausesenvironmentalharm.Inothercases,agencieshaveoverstatedprojects’benefitswhilehidingnegativeimpacts,retaliatedagainstwhistleblowers,andhidexculpatorylaboratoryevidence from the criminally accused.
Worse still is the persistent lack ofaccountability for scientific misconduct. Theexecutivebranchhasrecentlydevelopedascientificintegritypolicy,andyetmisconductcomplaintscanstill go unaddressed and scientific whistleblowersstillsufferretaliation. Andinthiscase,thefederalcourtshavedeclaredthattheylackjurisdictiontosetasideagencydecisionsforabuseofdiscretionevenwhen they are based in part on scientificmisconduct.
Althoughmostjudgesprofessnospecialscientificexpertise,theydohaveanimportantroleinensuringscientificintegrityingovernmentdecision-making.InDaubert,theSupremeCourtrecognizedthatjudgescanandshouldactasgatekeepersto screenunreliablesciencefromthereliable. Theabuseofscienceinthiscasegoes far beyondharmlesserrors,unreliabledata,differencesofopinion,orhonestmistakes.TheCourtshouldtake thiscasetomakeclearthatjudgescanandshouldprovidearemedywhengovernmentdecisionsarebased on scientific misconduct.
ARGUMENT
- SCIENTIFIC MISCONDUCTUNDERMINES OURDEMOCRACY:THREE EXAMPLES
A. Drakes Bay Oyster Company
OnthewesterncoastofthecontinentalUnitedStates,inPointReyes,California,justnorthofSanFrancisco,isan80-yearoldfamily-runoysterfarm,DrakesBayOysterCompany.When Point ReyeswasacquiredbytheNationalParkService(creatingPointReyesNationalSeashore),thePark Serviceandeveryinterestedcivicandenvironmentalgroupsupportedthelong-termcontinuationofthefarm.Itwasahistoriccollaborationbetweenenviron-mentalistsandagriculturalistsinwhathasbecomeahugelysuccessfulmodelfortherestoftheworld–thatproductionofwholesomefoodcanexistin harmonywith protectionof the environment.3
Forthepasteightyears,however,apatternhasdevelopedoftheParkServiceandsomeofthosesameenvironmentalgroupsmakingonefalseclaimofenvironmentalharmafteranotheragainstthe oysterfarm.Thefalseclaimsofenvironmentalharmbeganin2006,whenlocalParkServiceofficialsbeganclaimingthattheoysterfarmwaspolluting
3 ForanextendeddiscussionofthesupportthefarmenjoyedfromtheParkService,andenvironmentalgroupsliketheSierraClubandtheEnvironmentalActionCommitteeofWestMarin,duringthecreationoftheSeashoreandthepassageofwildernesslegislationthere,seegenerallyBriefOfDr.LauraWatt,AmicusCuriaeInSupportOfPetitionForRehearingEnBanc(Oct.25,2013),NinthCircuitdocket(“CA9dkt.”)no.78-1.
the water,smotheringeelgrass,harmingfish,anddegradingtheecology.Mostalarmingly,in 2007,ParkServiceofficialssaidtheoysterfarm’sownersshouldbeprosecutedforcommitting“environmentalfelonies”becausethefarmallegedlycausedan80%declineinthelocalharborsealpopulation,a protected marine mammal.4
Thesechargesweresurprising.Clams,oysters, and other shellfish were an important part oftheenvironmentalbaselineforDrakesEstero,5justastheywereforSanFranciscoBayandothercoastalbaysandestuariesaroundtheworldbeforemostwerefishedoutordestroyedbypollution.Oystersactuallyprovideenvironmentalbenefitsbyclarifyingwater.Thosebenefitsarewhyoystersarebeingrestoredinprojectsaroundtheworld.AndthosebenefitsarewhyCongress,intheCleanWaterAct, listedthe“protectionandpropagationof…shellfish”asoneofthegoalsofreducedpollutionandcleanerwater.33 U.S.C. § 1251(a)(2).
TheParkService’ssurprisingchargespromptedthePresidentoftheMarinCountyBoardofSupervisorstoaskDr.Goodmantoreview theParkService’sdata.Dr.Goodmanfoundthatthepubliclyavailabledatadidnotsupporttheclaimsofmajoradverseimpactsonwaterquality,sediments,eelgrass, fish, or the ecology.
TheParkService’sharborsealclaimswerealsofalse. HarborsealpopulationsinDrakesBay
4Districtcourtdocket(“N.D.Cal.dkt.”)no.39-1at38.ReferencestopagenumbersindocumentsfiledbelowaretothepagenumberECF-stampedtothetopofthedocument.
5N.D.Cal.dkt.no.39-2at20.
werestable,withsomedisturbancescomingfromwildlife,othersfromparkvisitors,butnonefromtheoysterfarm.Threeyearslater,theParkServiceformally retracted its 80%-decline claim.
In2009,theNationalAcademyreleasedareportontheParkService’sclaims.6ItfoundthattheParkServicehad“selectivelypresented,overinterpreted, ormisinterpreted”the availabledata,andconcludedthat,atDrakesBay,“thereisa lackofstrongscientificevidencethatshellfish farminghas major adverse ecological effects”.7
Bythatpoint,theParkServicehadretractedmostoftheclaimsitmadeagainsttheoysterfarmin2006.InJanuary2011,theDepartmentoftheInteriorreleasedascientificintegritypolicy.8Aroundthesametime,theSolicitor’sOfficeoftheDepartmentofInteriorconcludedthatParkServicescientistsshowed“bias”,“advocacy”,a“troublingmind-set”,andthatfiveemployeeshad“violated[theParkService]CodeofScientificandScholarlyConduct”.9
With the retractionof the false claims, rebukesbytheNationalAcademyandtheParkService’sownlawyers,andtheinstitutionofanewscientificintegritypolicy,therewasreasontohopethattheParkService’suseofscienceconcerningtheoyster
6Id.
7Id.at85-86,99.
8DepartmentoftheInterior,IntegrityofScientificandScholarlyActivities(January28,2011),availableathttp://elips.doi.gov/elips/0/doc/3045/Page1.aspx.
9N.D.Cal.dkt.no.40-1at36-37.
farmwouldimproveasthedecisionontherenewalofthe farm’s permit approached in 2012.
Instead,thepatternoffalseclaimscontinued.Again,themainculpritwastheParkService’sclaimsaboutadverseimpactstoharborseals.In2009,theNationalAcademyconcludedthatinadequatedataexistedtosupporttheParkService’sclaimthatthefarmdisturbstheseals,butrecommendedthatthecontroversycouldberesolvediftheParkServiceestablishedacamerasurveillancesystem.10Infact,suchaprogramhadsecretlybeeninplacesince2007,collectingphotographsofsealsandoysterboatseveryminuteofthedayduringpuppingseasonforoverthreeyears—foratotalofmore than 300,000 photographs.11 TheParkService’sprivateanalysisofthosephotographswaswithheldfromtheNationalAcademyandthepublic,presumablybecausethatanalysisdidnotrevealdisturbances by the farm.12
Inearly2012,theParkServicecontractedoneoftheworld’sforemostmarinemammalbehaviorexperts,Dr.BrentStewart,tore-analyzethephotos.Dr.StewartsubmittedhisreportinMay2012.13Dr.Stewartfound“noevidenceofdisturbance”ofsealsbyoysterboats.14Dr.Stewart’sreportshouldhavefinally put the issueto rest.
10N.D.Cal.dktno.39-2at59-60.
11N.D.Cal.dktnos.40-1at17and41-3at5.
12N.D.Cal.dktno.40-1at13-14.
13ExcerptsofRecord(“ER”)279-285.
14Id.; see also N.D. Cal. dkt. no. 52-1 at 29-35 (Dr.Goodman’sanalysisofDr.Stewart’sreport).
Unfortunately,itdidn’t.OnNovember20,2012,theParkService released anenvironmentalimpactstatement(EIS)ontheoysterfarm.TheEISconcludedthattheoysterfarmhasasignificant “adverseimpact” onharborseals.15Dr.Stewart’sfinding of “noevidence of disturbance”wastransformedintoafalsefindingthatthefarmdidinfactcauseseriousdisturbances.16Thismanipulationofresearchresultsisaformofscientificmisconduct known as falsification. SeePart II.A below.
Aweeklater,SecretarySalazardecidednottorenewtheoysterfarm’spermit,citing,inpart,theconclusionsaboutenvironmentalharmintheEIS.17Ideology had triumphed over science.18
15SupplementalExcerptsofRecordat58.
16ER284-285.
17Petitioners’Appendixat162.
18Inthedistrictcourt,Dr.Goodman’sopinionthattheEIS“misrepresents”Dr.Stewart’sconclusionsaboutharborsealswentunrebutted.ER188.InitsbrieftotheNinthCircuit,InteriortriedtodefendtheEISbycitingastudyfromtheMarineMammalCommission(“MMC”).CA9dkt.no.36-1at55n.10.ButtheMMCreportdoesnothingtosupporttheEIS’sharborsealconclusions.AfterreviewingthethreeyearsofParkServicephotographsatissuehere,theMMCdescribedasinglepotentialoyster-boat-relateddisturbanceonMay15,2008,andadvisedthata“fullerexamination”ofthephotographswasnecessarytoformanyconclusions“withareasonablelevelofconfidence”.MarineMammalCommission, Mariculture AndHarbor Seals In DrakesEstero,Californiaat27(November22,2011).Dr.Stewartconductedjustsuchafullerexaminationofthephotographs,andheconcluded,withparticularreferencetothepotentialdisturbanceonMay15,2008,thatthere
B. KlamathRiverDams Removal
WateruseintheKlamathBasininOregonandCaliforniahasbeenasourceofconflictbetweentribes,farmers,environmentalists,apowercompany,andthegovernmentsfordecades.In2002,manyblamedamassiveChinooksalmonkillonanallegedlypoliticallymotivateddecisiontodivertwatertofarmersratherthantoinstreamflows.A2004NationalAcademyofSciencesreportcomplicatedthepicturebyconcludingthatpoorwaterquality,ratherthanlowinstreamflows,wasthemainrisktothreatenedandendangered species.19
WhentheObamaadministrationcameintooffice,itbeganconsideringabillion-dollarprojecttoremovefourdamsontheKlamathRiver.Therewasnevermuchdoubtabouttheoutcome:in2009,InteriorSecretarySalazariswidelyreportedtohave
was“noevidenceofdisturbance”.N.D.Cal.dkt.no.52-1at15.TheDirectoroftheMMClateradmittedinalettertoDr.Goodman(blindcopiedtotheParkService)thattherewasnoevidencesupportingtheMMCclaimsofharborsealdisturbancesbytheoysterfarm.Editorial,“InPrivateLetter,TimRagenAdmitsNoEvidenceForSealStudy”,PointReyesLight(August9,2012),availableathttp://www.ptreyeslight.com/article/private-letter-tim-ragen-admits-no-evidence-seal-study.
19NationalResearchCouncil,EndangeredAndThreatenedFishesInTheKlamathRiverBasin:CausesOfDeclineAndStrategiesForRecoveryat5-6(2004),available at http://www.nap.edu/catalog.php?record_id=10838.
proclaimed that the proposal to remove the dams“will not fail”.20
InApril2011,theBureauofReclamation(anagencywithinInterior)hiredDr.PaulHouserasitsScienceAdvisorandScientificIntegrityOfficer—apositioncreatedafterInteriorreleaseditsscientificintegrity policy in January 2011.
InSeptember2011,InteriorreleasedadraftEISforthedamremovalproject.Dr.HousercomplainedtohissuperiorsthatthedraftEISanditsaccompanyingpressreleasemisrepresentedthesciencepanelreportsthathadbeencommissionedonthedamremovalproject,emphasizingthepositivebenefitswithouttheuncertaintiesornegativesidentifiedbythepanel.InFebruary2012,justonemonthbeforeSecretarySalazarwasscheduledtoformallymakehisdecision,Dr.Houserwasterminated.HebelievedthiswasretaliatoryandintendedtopreventhimfrominvestigatingwhetherthefinalEISwasalsotaintedbyscientificmisconduct.Inresponse,hefiledawhistleblowercomplaintwithInterior’sInspectorGeneralaswellasascientificmisconductcomplaintwithInterior’sScientific Integrity Officer.21
20JohnBowman,“SecretaryOfInteriorAnnouncesResignation”,TaftMidwayDriller(Jan.17,2013),availableathttp://www.taftmidwaydriller.com/article/20130117/NEWS/130119808/0/FRONTPAGE.
21LetterfromDr.PaulHouser,ScientificIntegrityOfficer,BureauofReclamation,totheDepartmentoftheInterior,AllegationOfScientificAndScholarlyMis-conductAndReprisalForADisclosureConcerningTheBiasedSummarizationOfKeyScientificConclusionsForTheKlamathRiverDamRemovalSecretarialDeterminationProcess(February24,2012),availableat
InMarch2013,InteriorreleasedareportonDr.Houser’sscientificintegritycomplaint.22ThereportwaswrittenbyanoutsideconsultantwhosemainclientisInterior.23Interiortaskedtheconsultantwithansweringagivenasetofquestions,andtheconsultantdidnotinterview witnesses.24Thereportdismissedthechargeof“misconduct”asbut“normalpractice”.25Interior’sScientificIntegrityOfficer,whoreportstotheSecretaryofInterior,agreed and closed the case.
InMay2013,theHouseofRepresentatives CommitteeonNaturalResourcesreleasedareportonInterior’sInspectorGeneral,highlightingtheKlamathRiverscientificintegritycomplaintbecauseofwhattheCommitteeconcludedwerefailuresofbothInteriorandInterior’sInspectorGeneral(IG).26The House Committee reported that an IG
http://www.peer.org/assets/docs/doi/8_8_12_Houser_sci_integ_complaint.pdf.
22RESOLVE,IndependentEvaluationOfTheScientificRecordPertainingToTheAllegationsOfDr.PaulHouser(August2012)(“RESOLVEreport”),availableathttp://www.doi.gov/scientificintegrity/upload/DOI-SI-Case-313-Independent-Report.pdf.
23 SeeRESOLVEReportsandPapers,availableathttp://www.resolv.org/resources/reports-papers(listingRESOLVEreportsdoneforInterior).
24 RESOLVEreport,supra,at4-7.
25 Id.at9.
26U.S.HouseofRepresentatives,CommitteeonNaturalResources,OfficeofOversightandInvestigations:HoldingInteriorWatchdogAccountable,59-66(February21,2013),availableathttp://naturalresources.house.gov/uploadedfiles/oversightreportdepartmentofinterior.pdf.
investigatorthoughtitwaslikelythatDr.HouserwasterminatedbecauseInteriordisagreedwithhisscientificanalysis.Theinvestigatorsthoughtthe reasonscitedbyInteriorfortheterminationwere“trivial”.Still,Dr.Houserhasnotbeenreinstated,andbothhiswhistleblowerandscientificmisconductcomplaintshave been quietly dismissed.
C. DepartmentofJustice
Inawidelynoticedrecentdissent,ChiefJudgeAlexKozinskioftheNinthCircuitCourtofAppealscriticizedan“epidemic”ofDepartmentofJusticeprosecutorsfailingtodiscloseexculpatoryscientificinformationtodefendantsandthecourts.UnitedStatesv.Olsen,737F.3d625,626(9thCir.2013)(Kozinski,C.J.,dissentingfromdenialofreh’genbanc),petitionforcertiorarifiledApril24,2014(no.13-1287).InOlsen,theprosecutorfailedtodisclosethatthekeypieceofforensicevidence—labresultsfindingthatpillswerelacedwith poison—wascreatedbyapolicetechnicianwhohadbeenterminatedfor“grossmisconduct”incontaminating manyotherlabsamplesinothercases.Id.at627.ChiefJudgeKozinskiconcludedaboutthescience:“nearlyeverythingthedistrictjudgeunderstood tobetrue was false”.Id.at 628.
But that was not an isolated case.ChiefJudge Kozinskicitedthe“distressinglycommon”phenomenonthathascometolightinrecentyears,involvingmanythousandsofcases,oflabtechniciansfalsifyingtheirresultstosupportaprosecution.Id.at632.AndprosecutorsfromJusticehavetoooftenobliged:“IwishIcouldsaythattheprosecutor’sun-professionalismhereistheexception…[b]utitwouldn’tbetrue”.Id.at631.Insupport,hecited29publishedappellateopinionsfromjustthelastten yearsinwhichcourtsaroundthecountryfoundthat
prosecutorshadfailedtodiscloseexculpatoryevidence.Id.at631-632.Presumablymanymorecaseshavegoneundiscoveredbecause“alltheincentivesprosecutorsconfrontencouragethemnottodiscoverordiscloseexculpatoryevidence”.Id.at630.
ChiefJudgeKozinskirecognizedthatscientific misconductbyJusticeiscorrosivetooursystemofgovernment,andthatcourtshaveashareoftheresponsibility:
Whenapublicofficialbehaveswithsuchcasualdisregardforhisconstitutionalobligationsandtherightsoftheaccused,iterodesthepublic’strust inourjusticesystem,andchipsawayatthefoundationalpremisesoftheruleoflaw.Whensuchtransgressionsareacknowledgedyetforgivenbythecourts,weendorseandinvite their repetition.
- at632.Heconcludedbyurgingcourtsto“sendprosecutorsaclearmessage”byvacatingthe“ill-gotten conviction”. Id.at 633.
II. THEREISALACKOF ACCOUNTABILITYFOR SCIENTIFICMISCONDUCTINGOVERNMENT
- Need For Scientific IntegrityPolicyBecomesApparent
Historically,scientificresearchreliedonaself- regulatinghonorsystem.Inthe1980’s,however,thescientificcommunitywasrockedbyaseriesofhighlypublicizedcasesofscientificmisconduct.Asaresult,thefederalgovernmentsetintomotionpoliciesto
oversee research conduct, and adjudicate researchmisconduct.
In1981,asubcommitteeofCongress,undertheleadershipofthen-CongressmanAlGore,heldhearingsonfraudinbiomedicalresearchinresponsetowidespreadreportsofscientistsfalsifyingtheirdata. Such cases wereexposedin several books.27
Congress,thepublic,andmanyothersinthescientificcommunitywantedoversightoffederally fundedresearch.CongressionalhearingscalledforinvestigationoftheNationalInstitutesofHealth(“NIH”)andotherfederalagencies.Inresponse,variousscientificsocietiesissuedguidelinesforresearchconduct.Thetwofederalagenciesthatsponsorthemostfederallyfundedresearch,NIHandtheNationalScienceFoundation(“NSF”),releasedscientificmisconductpoliciesinthemidtolate1980’s.Bythelate1980’s,theNationalAcademyofScienceswasaskedtoproposeaunifiedfederalpolicy.
In1992,theNationalAcademyrespondedbyreleasingareportthatproposedadefinitionofscientificmisconduct:“fabrication,falsification,orplagiarism,inproposing,performing,orreportingresearch”.28(NSFaddedretaliationagainstwhistleblowerstoitsdefinition.)ThereportrecommendedthatanofficeintheWhiteHouse,the
27E.g.,WilliamBroadandNicholasWade,BetrayersOfTheTruth:FraudAndDeceitInTheHallsOfScience(1982).
28NationalAcademyofSciences,ResponsibleScience:EnsuringtheIntegrityoftheResearchProcessat27(1992),availableathttp://nap.edu/catalog.php?record_id=1864.
OfficeofScienceandTechnologyPolicy(OSTP),establishcommongovernment-widedefinitionsandproceduresforconfrontingtheproblem.Aunifiedfederalpolicy,soitseemedatthetime,waswithingrasp.
Eightyearslater,in2000,OSTPfinallyissueda“FederalPolicyonResearchMisconduct”thatinstructedagenciestoimplementthepolicy.Someagenciescomplied; others—including theDepartment of the Interior—did not.
B. The RockyDevelopmentAndImplementationOf The President’sScientificIntegrityPolicy
InMarch 2009,shortly aftercoming into office,PresidentObamareleasedaMemorandumonScientificIntegrityanddirectedOSTPtoprovidedetailed guidelines within120 days.29
ThePresident’spolicygotofftoarockystart.IttookOSTPeighteenmonthstoreleaseamerefourpagesofguidelines.30Thoseguidelines providedlittleguidance.Insteadofprovidingconcretestan-dardsorcommonproceduresforeverygovernmentagencytofollow,astheNationalAcademyhadrecommendedin1992,theguidelinesgaveindividualagencies nearly complete discretion by
29 Presidential Memorandumon Scientific Integrity(March 9, 2009), available at http://www.whitehouse.gov/the-press-office/memorandum-heads-executive-departments-and-agencies-3-9-09.
30 John P. Holdren, Director, Office of Science andTechnologyPolicy,MemorandumonScientificIntegrity,(December 17, 2010), available at http://www.whitehouse.gov/sites/default/files/microsites/ostp/scientific-integrity-memo-12172010.pdf.
recommendingthateachagencydevelopitsownpolicies.Andtheguidelinessaidnothingatallabouthowscientificmisconductshouldbeinvestigatedorhowerrors shouldbe corrected.
TheshortcomingsofthePresident’sscientificintegritypolicyandtheOSTPguidelinesaremanifest in each of the cases discussed in Part I.
InthecaseofDrakesBayOysterCompany,effortstogetthefalsifiedscienceintheEIScorrectedhavebeenrejectedorignored.InDecember2012,theParkServiceDirectordismissedaformalcomplaintundertheDataQualityAct31onthegroundthattheSecretary’sdecision“mooted”anyrequirementtocorrectthescienceintheEIS.32AndtheDepartmentofInteriorhasstillnotevendecidedwhether itwill openaformalinvestigation intoaformalscientificmisconductcomplaintDr.GoodmanfiledoneyearagoinMay2013.33(Todate,nearlyeveryoneinvolvedwiththeParkService’sfalsescience in this casehas been promoted.)
Meanwhile,initsbriefstotheNinthCircuitin this case, Interior has continued to cite the EIS’s
31P.L.106-554§515,114Stat.2763A-153-154(December
21,2000).
32 Letter from Jonathan B. Jarvis, Director, NationalPark Service, to Amber D. Abbasi, counsel for Dr.Goodman (Dec. 21, 2012), available athttp://causeofaction.org/assets/uploads/2013/03/FINAL-Report_Exhibits.pdfatExhibit51(page1003).
33See Emily Yehle, “Rushed USGS Report On OysterFarm Misrepresented Biologist’s Findings”, Greenwire(May 14, 2013), available at http://www.eenews.net/greenwire/stories/1059981143 (describing complaint).
conclusionsaboutadverseimpactstoharborsealsasareason why the farmshould be removed.34
InthecaseoftheKlamathRiver damsremovalproject,thewhistleblowerDr.Houserwasfiredandhismisconductcomplaintshavebeendismissedbyaprocessripewithconflictsandlacking independence, transparency,and accountability.
AndintheOlsencase,thegovernmenthassofarnotconcedederror,andtheJusticeprosecutorwhohidtheexculpatoryevidencehas(toourknowledge)notbeenheldaccountable,eventhoughJusticehasascientificintegritypolicythatacknowledgesthattheDepartmentis“entrustedwithawesomeresponsibilities”andcommitsto“pursue,relyuponandpresentevidencethatiswell-foundedinfactand veracity”.35
Unfortunately,thePresident’sscientificintegritypolicyandOSTP’sguidelineshavefailedtoensureindependentinvestigations,accountabilityfor
34InopposingDrakesBay’smotionforaninjunctionpendingappeal,InteriorquotedtheParkService’sEIS’sconclusionthatDrakesBaycauses“long-termmoderateadverseimpacts”toharborsealsinsupportoftheargumentthat“thepublicinterestinthequalityoftheDrakesEsteroenvironmentweighsagainstaninjunction”.CA9dkt.no.17-1at20-21.AndinInterior’soppositiontoDrakesBay’smotionforastayofthemandatependingcertiorari,Interioragainarguedthat“theParkService’sinterestinprotectingharborsealsinDrakesEsteroduringpuppingseasonisanequitablefactor”supportingclosureofthefarm.CA9dkt.no.105at11-12.
35 DepartmentofJustice,ScientificandResearchIntegrityPolicy,at1,availableathttp://www.justice.gov/open/doj-scientific-integrity-policy.pdf.
scientificmisconduct,whistleblowerprotections,andcorrectionof egregious errors.
III. COURTS HAVE ANIMPORTANTROLEINENSURINGSCIENTIFIC INTEGRITYIN GOVERNMENT
Twentyyearsago,inDaubert,thisCourtheldthatfederaljudgeshavethe“gatekeeping”roleinensuringthatonly“scientific…knowledge”isusedasexpertevidenceincourt.Daubertv.MerrellDowPharms.,509U.S.579,590,597(1993)(quotingFed.
- Evid.R.702).Whatconstitutesscientificknowledge?ThisCourtexplainedthatitisbasednoton“subjectivebelieforunsupportedspeculation”,buton“themethodsandproceduresofscience”(i.e.,thescientificmethod).Id.at590(internalcitationandquotationmarks omitted).
Mostjudgesarenotscientists,andmany openlystrugglewithscreeningscientificknowledgefromtheunscientific.OnremandinDaubert,forexample,(then)JudgeKozinskicandidlyacknowledgedthatthisCourt’sholding“putsfederaljudges in an uncomfortable position”:
[S]cientistsoftenhavevigorousandsinceredisagreementsastowhatresearchmethodologyisproper,whatshouldbeacceptedassufficientprooffortheexistenceofa“fact,”andwhetherinformationderivedbyaparticularmethodcantellusanythingusefulabout the subject under study.
Ourresponsibility…istoresolvedisputesamongrespected,well-credentialedscientistsaboutmatterssquarelywithintheirexpertise,inareaswherethereisnoscientificconsensusas
towhatisandwhatisnot“good science,”andoccasionallytorejectsuchexperttestimonybecauseitwasnot “derived by the scientific method.”
Daubertv.MerrellDowPharmaceuticals,43F.3d1311, 1315-16 (9th Cir. 1995).
Ratherthanshirkingthisresponsibility,JudgeKozinskivowedto“takeadeepbreathandproceedwith this heady task”.Id.at 1316.
Intheyearssince Daubert,federaljudgeshaveprovencapableofmanagingthistask. JudgeOliver
- WangeroftheEasternDistrictofCalifornia,forexample,presidedoverextremelycomplexandcontentiousEndangeredSpeciesActlitigationabouttheDeltasmelt.SanLuis&Delta-MendotaWaterAuth.v.Salazar(the“DeltaSmeltCases”)(E.D.Cal.no.1:09-cv-00407).ThemainissueinDeltaSmeltCaseswaswhetherthesciencejustifiedrestrictingwaterexportsinCaliforniainordertoprotectthesmelt.Atthecloseofthetrialcourtproceedings,JudgeWangerfoundthatthetestimonyofthegovernment’sexpertslackedcredibility.36ToJudgeWanger,thoseexpertsweredrivenbyapolicygoaltorestrictexports,regardlessofwhatthescientificdatashowed.JudgeWangerexpectedbetterfromthegovernment:
I’mgoingtobemakingafindinginthiscaseofagencybadfaith.Thereissimplynojustification.Therecanbenoacceptance by a Court of the United
36 DeltaSmeltCases,BenchRulingonMotiontoStayPendingAppeal(Sept.16,2011),dkt.no.1056,availableathttp://plf.typepad.com/files/9-16-11-motion-to-stay-final-1.pdf
Statesoftheconductthathasbeenengagedininthiscasebythesewitnesses.
And I am going to make a very clear andexplicitrecordtosupportthatfindingofagencybadfaithbecause,candidly,theonlyinferencethattheCourtcandrawisthatitisanattempttomisleadandtodeceivetheCourtintoacceptingwhatisnotonlynotthebestscience,it’snotscience.37
JudgeWangerstressedthatthegovernmenthas a “duty” to use good science in its decisions:
[T]heUnitedStates,asasovereign,hasadutynotonlyindealingwiththeCourt,butindealingwiththepublictoalwaysspeak thetruth,whether itisgoodorbad.It’sneveraboutwinningorlosing,it’s always about doing justice.38
JudgeWangersawpasttheagency’spolicygoalsandtheflawedtestimonyofitsscientistsandruledthatthesciencedidnotsupporttheproposednewrestrictions,showingtheextremeimportanceofthe court’s role in scientific integrity.
Inthepresentcase,however,thepanelthrewupitshandsatthescience.Itproclaimedthatit lackedjurisdictiontoreviewpetitioners’claimsthatSecretarySalazar’sdecisionwasanabuseofdiscretionbecauseitwasbased,inpart,onfalsescience.PetitionforCertiorariat11-12.Andit createdaruleof“harmlesserror”inwhichagencies
37Id.at17:15-25.
38Id.at33:18-22.
canavoidresponsibilityforscientificmisconductsimplybyassertingthattheirdecisionsarenotbasedon flawed data. Id.at 32-33.
Thepanel’sdecision,ifallowedtostand,createsadangerous precedent.Ifcourtslack jurisdictiontoreviewclaimsthatagencydecisionsarebasedonscientificmisconduct,andifcourtsare requiredtoforgivescientificmisconductwheneveranagencymakesassurancesthatthemisconductwasimmaterial,thenagenciesarelikelytofeelless constrainedaboutfalsifyingscientificinformationtothecourtsandthepublic.Thisdecisionislikelytoresultinmorescientificmisconductingovernmentdecisions,and thus undermine our democracy.
TheSupremeCourtshouldtakethiscaseto makeclearthatthecourtscan,andshould,remedyscientificmisconduct.SeeGeneralElectric,Inc.v.Joiner,522U.S.136,146(1997)(courtscanrejectscientificclaimswhen“thereissimplytoogreatananalyticalgapbetweenthedataandtheopinionproffered”).Scientificmisconductisnotqualitativelydifferentfromthekindsofissuescourtshavenotroubleadjudicatinginothercaseseveryday.Ineventhemostcomplexbreachofcontractcases,forexample,courtsareroutinelyaskedtodetermine whetherapartyhasmadeamaterialmisrepresentationofthefacts.Inanalyzingthesetypesofclaims,courtscananddocomparetheunderlyingfactsagainsttherepresentationtoassesswhether they are consistent.
Thescientificmisconductclaimhereisreallynodifferent.ThefactsarethattheinternalanalysisbytheParkServiceanditsoutsideexpertwasthat thereisnoevidencethattheoysterfarmdisturbsharborseals.SeePartI.Aabove.Andyettherepresentation in the EIS, relied upon by the
Secretaryinmakinghisdecision,wasthattheoysterfarmcausessignificantadverseimpactstoharborseals.Thiswasnotacase wherethecourtwasaskedtochoosebetweenconflictingexpertopinions.Itisnotaboutunreliabledataorharmlesserrors.Thereisnothing“harmless”aboutaneight-yearpatternofParkServicemisrepresentationsaboutahistoricfamilyfarm.Thisisacasewheretheagencysimply falsifiedthescience,andthepanelshouldnothaverefusedto say so.
CONCLUSION
The petitionshould be granted.
Respectfully submitted,PETERS.PROWS
Counsel of Record
BRISCOEIVESTER&BAZELLLP
155 SansomeStreet,
Seventh Floor
San Francisco, CA 94104(415) 402-2700
Posted by Jane Gyorgy on May 19, 2014
https://oysterzone.wordpress.com/2014/05/19/05-19-2014-goodman-houser-amici-curiae-brief/
05-19-14 25 “Friends” File 4 Briefs Supporting DBOC effort to have Supreme Court hear its case
Twenty-Five “Friends” File Supreme Court Briefs Supporting
Drakes Bay Oyster Company
Farmers, Environmentalists, Scientists, Chefs, and Preservationists All Support Historic Oyster Farm
INVERNESS, CALIF. — Twenty-five “friends” of Drakes Bay Oyster Company have filed four significant amicus briefs in support of the farm’s efforts to have the U.S. Supreme Court hear its case. Together, the briefs make compelling arguments for why the Supreme Court should take the case.
At stake is whether the government, in making countless everyday decisions, can be taken to court when it abuses its power, misinterprets the law, or misrepresents science. The U.S. Court of Appeals for the Ninth Circuit held that a federal court does not have jurisdiction to review a discretionary agency decision for abuse of discretion. Drakes Bay Oyster Company petitioned the U.S. Supreme Court on April 14, 2014 for a writ of certiorari to review that judgment.
Elder environmentalists and agriculturalists support aquaculture
Former California Assemblyman William T. Bagley and former Congressman Paul Norton “Pete” McCloskey (co-author of the Endangered Species Act and co-chair of the first Earth Day) are among the elder environmentalists supporting the oyster farm’s petition. Also joining the brief are Patricia Unterman, chef-owner of Hayes Street Grill in San Francisco; chefs and owners of many of West Marin’s farm-to-table restaurants; and a host of agriculturalists and agriculture associations. The brief argues the importance of aquaculture and agriculture in the San Francisco North Bay, and for the support and development of innovative, ecologically sound and sustainable agriculture practices consistent with the purposes of the National Environmental Policy Act [NEPA].
Rural communities dependent on fair federal permitting
In its amicus brief, the Pacific Legal Foundation and California Cattlemen’s Association point out that roughly half of the land in the western United States is federally owned, and that grazing is one of the largest uses of federal lands. Together the Ninth and Tenth Federal Circuit courts each govern about half of all federal grazing permits, yet the two circuits are not aligned on fundamental questions of law relating to renewal of grazing permits, including the application of NEPA, and judicial review under the Administration Procedure Act [APA]. The brief argues that the high court should take Drakes Bay’s case in order to resolve this issue, since “a very large number of rural communities are dependent on federally permitted grazing for employment, commerce, and tax revenue to support public services.”
Scientific misconduct undermines our democracy
Two preeminent scientists, Dr. Corey Goodman (elected member, National Academy of Sciences) and Dr. Paul Houser (former Scientific Integrity Officer, Bureau of Reclamation, Department of the Interior, and Professor, George Mason University), filed a brief to argue that the Supreme Court should take this case as an opportunity to make clear that courts have an important role in ensuring scientific integrity in government. When he came into office, President Obama made clear that “to undermine scientific integrity is to undermine our democracy.” Yet for Drakes Bay Oyster Company, and too many other cases, the government has falsified and abused science to further predetermined ideological agendas. The Ninth Circuit held that a federal court does not have jurisdiction to reject false science, whereas the Supreme Court has historically held that they do. This brief asks the Supreme Court to reaffirm their commitment to the integrity of science both in government decision-making and as presented to federal courts.
Ninth Circuit decision endangers historic resources
The Monte Wolfe Foundation argues that the Ninth Circuit’s ruling hampers the protection of historic and cultural resources, writing: “the ruling of the Ninth Circuit, that no NEPA review is needed where agency action seeks to restore a pristine state of nature, appears unique to the Ninth Circuit. It means that historic resources on Ninth Circuit federal wildlands are endangered because they cannot depend on NEPA for protection. Absent other protection, they may be – indeed, given [the Ninth Circuit decision] Drakes Bay Oyster’s reading of the intent of NEPA, should be – summarily removed.”
Oyster farm remains open for now
At issue is former Secretary of Interior Ken Salazar’s denial of Drakes Bay’s permit to continue operating the 80-year-old oyster farm, even though the original deal for the creation of Point Reyes National Seashore was that the oyster farm was always supposed to stay. The Secretary’s decision was informed by a falsified environmental report. Because Drakes Bay showed that there is a “reasonable probability” that the Supreme Court will take this case and a “significant possibility” that the oyster farm will win, the Ninth Circuit has allowed Drakes Bay to remain open while it takes its case to the Supreme Court.
About Drakes Bay Oyster Company
The historic oyster farm in Drakes Estero, located in Point Reyes, Marin County, has been part of the community for nearly 100 years. The Lunnys, a fourth-generation Point Reyes ranching family, purchased the oyster farm in 2004. Modern environmentalists and proponents of sustainable agriculture praise Drakes Bay Oyster as a superb example of how people can produce high-quality food in harmony with the environment. The farm produces approximately one third of all oysters grown in California, and employs 30 members of the community. The Lunnys also contribute the oyster shells that make possible the restoration of native oysters in San Francisco Bay and the oyster shells used to create habitat for the endangered Snowy Plover and Least Tern. As the last oyster cannery in California, Drakes Bay is the only local (and thus the only safe and affordable) source of these shells. The Lunny family is proud of its contributions to a sustainable food model that conserves and maintains the productivity of the local landscapes and the health of its inhabitants. For more information, please visit www.drakesbayoyster.com and www.savedrakesbay.com
For Immediate Release
May 19, 2014
Contacts: Tina Walker
Office: 415.227.9700
Cell: 650.248.1037
Email: tina@singersf.com
Peter Prows
Counsel for Drakes Bay Oyster
Email: pprows@briscoelaw.net
Posted by Jane Gyorgy on May 19, 2014
https://oysterzone.wordpress.com/2014/05/19/05-19-14-25-friends-file-4-briefs-supporting-dboc-effort-to-have-supreme-court-hear-its-case/
04-16-14 Marin Superior Court Judge Chernus says “will take it under advisement” at end of hearing
04-16-14 Judge Chernus listened attentively to arguments from both sides, took notes, and at the end of the hearing stated “You’ve given us a lot to think about. I will take it under advisement and get back to you.”
His honor did not specify a date by which he will let us know his decision. Nevertheless, the attorneys are speculating the final ruling may be out within the next three weeks. The ruling could come as early as tomorrow yet on the other hand, it doesn’t have to be out for months from now.
Posted by Jane Gyorgy on April 16, 2014
https://oysterzone.wordpress.com/2014/04/16/04-16-14-marin-superior-court-judge-chernus-says-will-take-it-under-advisement-at-end-of-hearing/
04-15-14 Judge Ruled Ca. Coastal Comm. Violated Environmental Law & Abused its Discretion
04-15-14
Marin Superior Court, Judge Chernus,
issued his temporary ruling today stating the
California Coastal Commission violated environmental law
by not conducting an environmental review, and
abused its discretion by excluding Drakes Bay Oyster Farm evidence.
Racks and buildings need not be removed.
Didemnum measures struck down.
Existing Manila clams can stay.
To read the ruling, please click on the link below.
This is a tentative ruling.
All parties will appear in Marin County Superior Court, Department B, tomorrow morning, 04-16-14 at 8:30 AM to present arguments.
Posted by Jane Gyorgy on April 15, 2014
https://oysterzone.wordpress.com/2014/04/15/04-15-14-judge-ruled-ca-coastal-comm-violated-environmental-law-abused-its-discretion/
04-14-14 Attorney asks: “Are federal agencies immune from judicial review of their decisions?”
Drakes Bay Oyster Company seeks review in US Supreme Court
Today, Drakes Bay Oyster Company filed its petition for certiorari in the United States Supreme Court, after the Ninth Circuit Court of Appeals decided that the federal government’s decision to shut down the oyster farm is immune from judicial review.
The petition raises a fundamental question that strikes at the heart of the administrative state: exactly how often are federal agencies immune from judicial review of their decisions? The Administrative Procedure Act authorizes review in federal courts of federal agency decisions when they are arbitrary, capricious, abusive of the agency’s discretion, or otherwise not in accordance with law. But many courts across the nation have held that they have no jurisdiction to review agency decisions unless Congress specifically provides statutory guidelines for the exercise of agency discretion. This legal perspective boils down to the proposition that Congress can (and frequently does) delegate unlimited power to executive agencies to make permitting and other regulatory decisions for any reason or no reason, subject to no substantive or even procedural safeguards for citizens and their liberty and property.
Fortunately, many other federal courts have ruled the opposite: that courts can and must review whether discretionary agency actions are arbitrary, capricious, abusive, or otherwise contrary to law. The oyster farm’s petition to the Supreme Court clearly identifies the scope of this ongoing conflict within the federal courts of appeals, making this a very good opportunity for the Supreme Court to resolve this fundamental question of executive accountability and availability of judicial review.
You can learn more about the oyster farm’s fight for justice from our video http://www.youtube.com/watch?v=4j2Om3W-Ofo
Or listen to our January 15 podcast.
Posted by Jane Gyorgy on April 14, 2014
https://oysterzone.wordpress.com/2014/04/14/04-14-14-attorney-asks-are-federal-agencies-immune-from-judicial-review-of-their-decisions/
04-14-14 Drakes Bay Oyster Files Petition for Writ of Certiorari in U.S. Supreme Court
April 14, 2014
Contacts: Tina Walker
Office: 415.227.9700
Cell: 650.248.1037
Email: tina@singersf.com
Peter Prows
Counsel for Drakes Bay Oyster
Email: pprows@briscoelaw.net
Drakes Bay Oyster Files Petition for Writ of Certiorari in U.S. Supreme Court
Petition asks high court to review Ninth Circuit decision
INVERNESS, CALIF. — Drakes Bay Oyster Company has petitioned the U.S. Supreme Court for a writ of certiorari to review the judgment of the United States Court of Appeals for the Ninth Circuit in its case.
At issue is former Secretary of Interior Ken Salazar’s denial of Drakes Bay’s permit to continue operating the 80-year-old oyster farm, even though the original deal for the creation of Point Reyes National Seashore—supported by the Park Service, the Sierra Club, the Environmental Action Committee of West Marin, and every other interested environmental and civic group—was that the oyster farm was always supposed to stay. The Ninth Circuit held that a federal court does not have jurisdiction to review a discretionary agency decision for abuse of discretion. At stake is whether the government, in making countless everyday decisions, can be taken to court when it abuses its power.
“If this judgment is not overturned, government agencies will have the power to deny a permit to any individual or business for any reason, without judicial review,” said Kevin Lunny, owner of Drakes Bay Oyster Company. “Citizens must have recourse in the face of an arbitrary and capricious decision.”
The small, family-owned farm has been in a heated legal battle with federal regulators for its survival. Because Drakes Bay showed that there is a “reasonable probability” that the Supreme Court will take this case and a “significant possibility” that the oyster farm will win, the Ninth Circuit has allowed Drakes Bay to remain open while it takes its case to the Supreme Court.
One reason the Supreme Court might want to hear the case is to resolve fifteen circuit splits on three issues—that is, issues on which two or more circuits in the U.S. court of appeals system have given different interpretations of federal law. The splits in this case are on important issues: jurisdiction to review agency actions for abuse of discretion, applicability of the National Environmental Policy Act (NEPA), and prejudicial error under the Administrative Procedure Act (APA). Read the Petition for Writ of Certiorarihere.
About Drakes Bay Oyster Company
The historic oyster farm in Drakes Estero, located in Point Reyes, Marin County, has been part of the community for nearly 100 years. The Lunnys, a fourth-generation Point Reyes ranching family, purchased the oyster farm in 2004. Modern environmentalists and proponents of sustainable agriculture praise Drakes Bay Oyster as a superb example of how people can produce high-quality food in harmony with the environment. The farm produces approximately one third of all oysters grown in California, and employs 30 members of the community. The Lunnys also contribute the oyster shells that make possible the restoration of native oysters in San Francisco Bay and the oyster shells used to create habitat for the endangered Snowy Plover and Least Tern. As the last oyster cannery in California, Drakes Bay is the only local (and thus the only safe and affordable) source of these shells. The Lunny family is proud of its contributions to a sustainable food model that conserves and maintains the productivity of the local landscapes and the health of its inhabitants. For more information, please visit www.drakesbayoyster.com and www.savedrakesbay.com
04-14-14 US Supreme Court Cert Petition Press Release With Links
Posted by Jane Gyorgy on April 14, 2014
https://oysterzone.wordpress.com/2014/04/14/04-14-14-drakes-bay-oyster-files-petition-for-writ-of-certiorari-in-u-s-supreme-court/
ALSA, Faber & DBOC vs Ca Coastal Commission, Tentative Ruling Tuesday 04-15-14, Hearing Wednesday 04-16-14
Location: Marin Superior Court
Time: 8:30 AM
Judge: Chernus
Dept: B
Posted by Jane Gyorgy on April 11, 2014
https://oysterzone.wordpress.com/2014/04/11/alsa-faber-dboc-vs-ca-coastal-commission-tentative-ruling-tuesday-04-15-14-hearing-wednesday-04-16-14/
03-04-14 REPLY IN SUPPORT OF MOTION FOR PEREMPTORY WRIT OF MANDATE
EXCERPTS FROM THE BRIEF:
…. the “wholesale disqualification” of a party’s experts violates due process as a matter of law, ….
the exclusion of a “credible and substantial” expert report violates due process.
…the Commission violated due process by its wholesale disqualification of Drakes Bay’s expert testimony, which included credible and substantial expert reports. [the commission] never mentions either of the cases, ….
The Commission thereby concedes the issue, and the motion.
This due-process violation, alone, is enough to invalidate the Orders.
the Commission violated due process by not allowing for cross-examination, and that the Commission’s decision was not supported by competent evidence.
The California Coastal Commission responds with a series of small, mostly procedural arguments. All are wrong.
In the quasi-judicial proceeding at issue, the Commission
- did not act as an impartial judge
- was too happy to embrace criticisms of the oyster farm,
- was too hostile to any evidence that favored the farm,
- was too quick to dismiss evidence that rebutted the staff report.
- Its behavior demonstrated a desire to win at any cost, and no respect for the truth.
VII. CONCLUSION
This Court should issue an order declaring the Orders invalid, and issue a writ of mandate.
For the complete brief, click on or copy and paste the link below into your web browser:
03-04-14 Reply Brief ISO DBOC’s Motion for Peremptory Writ of Mandate
Posted by Jane Gyorgy on March 4, 2014
https://oysterzone.wordpress.com/2014/03/04/03-04-14-reply-in-support-of-motion-for-peremptory-writ-of-mandate/
01-30-2014 Marin Voice: “9th Circuit … Puts a Thumb on the Scale” (of Justice)
Marin Voice: Oyster ruling deserves another look
By Jim Linford
Guest op-ed column
THE Ninth Circuit has refused to rehear the oyster farm case with only one judge — an Obama appointee and the dissent’s author — voting to rehear it. The case will now go to the United States Supreme Court who may agree to hear it.
But the Ninth Circuit decision is very odd because, again and again, it puts a thumb on the scale.
First, it needlessly disparages — or at least trivializes — one side in the dispute. The opinion begins:
“This appeal, which pits an oyster farm, oyster lovers and well-known “foodies” against environmentalists aligned with the federal government, has generated considerable attention in the San Francisco Bay Area.”
While the court appears to take judicial notice of the public debate, it apparently does not acknowledge that sustainable agriculture is an environmentalist concern, and, most importantly, that there are environmentalists on both sides of the dispute. The court puts a thumb on the scale.
Second, the court disregards a universal legal maxim, general rules are understood broadly while exceptions, narrowly. In administrative law, the general rule is that courts have jurisdiction to review all governmental action. There are some exceptions to that general rule, but the exceptions should be narrowly applied. However, in the oyster farm case, the court oddly gives a very broad application to an exception — Article 124 — the court thus prevents itself from looking into irregularity in the Secretary of the Interior’s oyster farm decision. The court puts a thumb on the scale.
Third, the court muddles the geography of the oyster farm by failing to distinguish clearly between those parts of the farm that are within the wilderness zone and those parts that, like the farm buildings of the neighboring dairy ranches, are within the pastoral zone.
Only the oyster beds are within the wilderness. But by confuting the pastoral and wilderness zones, the buildings and the beds, the court leaves the impression of far greater impact on the wilderness. The court puts a thumb on the scale.
Fourth, the court treats the legislative intent at the creation of the seashore and the wilderness as something that can be lightly brushed aside by some sort of (in this case, merely tacit) indication of changed intent. However, the initial legislative intent that the agriculturalists — including the oyster farm — would continue to have their use permits renewed was part of the historic bargain between environmentalists and agriculturalists that created the seashore. As anyone who has seen the film “Rebels With a Cause” knows, without that bargain, the lands would have been lost to the urbanization of commercial real estate development. By ignoring the reality of the seashore’s origins, the court puts a thumb on the scale.
Given the historic bargain that preserved the seashore, it is absolutely outrageous to argue that the agriculturalists somehow gave up their traditional use of the land when they were in fact protecting it by transferring ownership to the Park Service.
Sustainable agricultural use has been an inextricable part of the texture of the seashore since its creation.
The Ninth Circuit’s unfair decision ignores that primordial reality and should now be taken up by the U.S. Supreme Court.
Jim Linford of Marinwood is a semi-retired appellate attorney who has filed a pro bono amicus brief in support of the oyster farm on behalf of an historic resource foundation
Posted by Jane Gyorgy on January 31, 2014
https://oysterzone.wordpress.com/2014/01/31/01-30-2014-marin-voice-9th-circuit-puts-a-thumb-on-the-scale-of-justice/
11-21-13 WMC Goodman Brief Details History of NPS False Science
Goodman Brief Details History of NPS False Science
By Sarah Rolph
Those who have closely followed the Drakes Bay Oyster Company (DBOC) controversy know that local scientist Dr. Corey Goodman became involved in April 2007 when Marin County Supervisor Steve Kinsey contacted Dr. Goodman, based upon his scientific credentials and experience in science and public policy, and asked him to analyze the National Park Service (NPS) science on Drakes Estero.
Kinsey then invited Dr. Goodman to testify as an independent scientist at the May 8, 2007 County hearing as to whether NPS data supported NPS claims. At the time, Dr. Goodman did not know Kevin Lunny, owner of Drakes Bay Oyster Company. Dr. Goodman’s analysis showed that NPS data did not support NPS claims, and he testified that NPS officials misrepresented their own data.
Goodman is passionate on the topic of scientific integrity. At the May 2007 meeting, he stated:
“I believe that public policy decisions can and should be informed by quality science. But this must be science conducted rigorously, without agendas or conflicts-of interest. The political process can be dangerously misled by bad or misused science. One of my greatest concerns when I see science being invoked in public policy debates is to make sure that it is good science and not pseudo-science or — even worse — a blatant misuse of science.”
The history of the DBOC controversy has shown these comments to be prescient. What has happened since 2007 has, sadly, been a blatant misuse of science.
Dr. Goodman’s Amicus brief supporting DBOC’s petition for en banc rehearing in the Ninth Circuit provides an excellent summary of this blatant misuse.
There is no scientific basis for the view—promulgated by the National Park Service (NPS) Final Environmental Impact Statement (EIS)—that the oyster farm causes significant environmental harm to Drakes Estero.
“To this day,” the brief argues, “NPS and their supporters continue to recite a fictional narrative that they have evidence of environmental harm, when they have no such evidence.”
Goodman’s brief details the shocking history of false NPS claims. As the brief explains:
“The EIS is the latest chapter in a seven-year effort by NPS to claim the oyster farm causes environmental harm. Again and again, NPS issued papers, reports and testimony claiming the oyster farm harms the environment. Each time, NPS had to correct, revise, or retract its claims after being sharply criticized by the National Academy of Sciences (NAS), the Department of the Interior’s Inspector General and Office of the Solicitor, or Congress. But each correction has proven to be a new opportunity for NPS to misrepresent the science on some new issue—be it eelgrass, sediments, fish, harbor seals, soundscape, and, most recently, a tunicate.
In the end, NPS spent millions of dollars searching for adverse environmental impacts that do not exist. It is difficult not to conclude that this pattern was intentional. It certainly was not harmless.”
The NPS EIS even claims that the oyster farm is bad for water quality.
In fact, the opposite is true: oysters, being filter-feeders, provide environmental benefits to the waters in which they live, which is why oyster restoration projects are under way globally. Just last week, on November 15, the San Francisco Chronicle featured on its front page an exciting update about the oyster restoration effort in San Francisco Bay (an effort made possible by the donation of DBOC oyster shells). (In case you missed it, that article is here: http://www.sfgate.com/science/article/2-million-oysters-in-bay-begin-restoration-effort-4984300.php)
The Ninth Circuit majority, having been misled by the NPS EIS, called removal of the oyster farm an “environmental conservation effort.” Unless NPS intends to remove the surrounding cattle ranches (which they publicly promise not to do), the prudent “environmental conservation effort” would be to allow the oysters to continue to filter and clarify the water, not to eliminate the oyster farm.
The false claims in the EIS were so outlandish that Congress expressed concern about “the validity of the science underlying the [Draft EIS]” and directed the National Academy of Sciences (NAS) to review it.
The NAS review pointed out that the EIS had it backwards—that the oysters are “beneficial” for the environment: “… the committee determined that an alternate conclusion on the overall impact of DBOC operations could be reached, with the beneficial effects of shellfish filtration outweighing the adverse impacts from sediment disturbance and the low levels of contaminants generated by DBOC activities.”
The EIS review is not the first time the Academy was asked by Congress to review NPS science. The NAS was also asked to get involved in 2009. They convened a scientific panel, held a series of public meetings, and ultimately released its review on NPS’s claims on May 5, 2009. That NAS panel came to two major conclusions:
- “[NPS] selectively presented, overinterpreted, or misrepresented the available scientific information on DBOC operations …”
- “… there is a lack of strong scientific evidence that shellfish farming has major adverse ecological effects on Drakes Estero.”
Nevertheless, the NPS continued to press its false narrative.
The details are incredible. For example, a secret camera program was put in place to monitor oyster workers without their knowledge. Apparently NPS was hoping to find evidence for its claims that oyster boats disturb seals—the three years of data from the secret cameras instead proved the opposite. The Park Service had those photos analyzed by outside experts, and the seal expert who reviewed them found the same result. The Park Service had no other evidence for its claims about seals, so it took the astounding step of changing the report, claiming in the EIS that the review found disturbance to seals—the opposite of what was actually found.
Please read the brief to learn the full story of the Park Service’s malfeasance. You can find it here: http://cdn.ca9.uscourts.gov/datastore/general/2013/10/25/13-15227_Amicus_brief_by_Dr_Corey_Goodman.pdf
The Citizen welcomes your letters and essays on this brief, and on all the briefs profiled in this series. Send your comments to editor@westmarincitizen.com
Posted by Jane Gyorgy on January 9, 2014
https://oysterzone.wordpress.com/2014/01/09/11-21-13-wmc-goodman-brief-details-history-of-nps-false-science/
02-06-13 Drakes Bay Oyster Company Appeals Judge’s Decision
Drakes Bay Oyster Company Appeals Judge’s Decision to Deny Injunction
Posted by Communications Staff in Highlights, Press, Press Releases & Statements on February 6, 2013 4:18 pm / no comments
FOR IMMEDIATE RELEASE
FEBRUARY 6, 2013
DRAKES BAY OYSTER COMPANY APPEALS JUDGE’S DECISION TO DENY INJUNCTION
The Lunny Family Continues the Fight to Keep the Farm in Business
SAN FRANCISCO – Cause of Action (CoA), a government accountability organization, Briscoe Ivester & Bazel LLP, and SSL Law today appealed Judge Gonzalez Rogers’s decision to deny an injunction for Drakes Bay Oyster Company, which would have allowed the company to remain open for the duration of the trial, Drakes Bay Oyster Company v. Salazar, et al. Without an injunction, the family farm will be required to cease all operations, destroy millions of un-harvested oysters, and force several families living on the farm to move elsewhere by February 28.
“We are committed to fighting against government abuse and overreach to keep the Lunny family in business,” said Amber Abbasi, Chief Counsel for Regulatory Affairs at Cause of Action, “and are taking all the necessary legal steps to appeal this ruling.”
Kevin Lunny, owner of Drakes Bay Oyster Company offered this brief statement on behalf of the farm:
“We continue to be grateful for the outpouring of support from our community. We have had time to weigh our options carefully, and have decided to appeal the judge’s decision.”
Cause of Action and Briscoe Ivester & Bazel LLP, and SSL Law represent Drakes Bay Oyster Company.
The judge’s decision can be found here.
Our Appeal and Exhibits can be found here.
About Cause of Action:
Cause of Action is a nonprofit, nonpartisan organization that uses investigative, legal, and communications tools to educate the public on how government accountability and transparency protects taxpayer interests and economic opportunity. For more information, visit www.causeofaction.org.
Posted by Jane Gyorgy on February 6, 2013
https://oysterzone.wordpress.com/2013/02/06/02-06-13-drakes-bay-oyster-company-appeals-judges-decision/
01-23-13 Dispelling the Myths about the DBOC Conflict with the NPS
Posted by Communications Staff in Blog on January 23, 2013 12:30 pm / no comments
The decision last November by Interior Secretary Ken Salazar not to renew The Drakes Bay Oyster Company’s lease was based on a number of inaccurate and misleading claims. Here are five myths that the Secretary, his supporters, and the National Park Service use to justify the oyster farm’s eviction from Drakes Estero:
Myth #1:
The Secretary’s decision was based on sound science.
National Park Service researchers claimed that oyster farming operations in Drakes Estero damaged eelgrass beds and upset seal breeding patterns. Yet other NPS reports contradicted these claims, and the National Academy of Sciences stated that the Park Service had “exaggerated the negative and overlooked the potentially beneficial aspects of the oyster culture operation.” Marine biologist Corey Goodman, who independently studied the farm’s impact on the region’s ecology, called the Park Service research “a stunning misuse of science by our federal government.” Secretary Salazar ultimately decided that the Park Service’s inaccurate Environmental Impact Study was “not material” to his final decision, ignoring federal law that requires such a study be taken into account.
Myth #2:
Renewing the lease would set a precedent.
Some people were concerned that allowing the oyster company to remain in Drakes Estero would create a model of privatization that other leaseholders in national parks could follow. However, the 2009 law granting Salazar the right to extend the lease another ten years expressly states that the provision would not be viewed as precedent. In fact, Salazar’s removal of the oyster company is likely to set a standard in the opposite direction, with more working farms and orchards expelled from national park lands.
Myth #3:
Removing the oyster farm would improve the region’s environmental health.
When owner Kevin Lunny first bought The Drakes Bay Oyster Company in 2004, he took out a $300,000 loan to clean and restore the farm. Because his family’s livelihood depended on the productivity of Drakes Estero, he was careful to keep the waters clean and productive by clearing the bay of debris and trash left by hikers and kayakers. The oysters themselves actually improved the bay’s water quality byfiltering out algae that inhibits eelgrass growth.
Myth #4:
The disagreement is between environmentalists and the agriculture industry.
As a committed environmentalist, Kevin Lunny turned The Drakes Bay Oyster Company into a model of sustainable agriculture. “It’s extremely healthy for the environment,” Mr. Lunny said. “There are no feeds, no fertilizers, no chemicals.” Biologist Corey Goodman called Mr. Lunny “one of the pioneers for organic and sustainable agriculture that also protects the environment.” Advocates for the consumption of locally-produced food to reduce its environmental footprint have long supported the oyster farm, which sells nearly all its product to tourists and local restaurants. With Drakes Bay accounting for 40 percent of the state’s oyster production, California restaurants will have to fly oysters in from the Pacific Northwest or East Coast, increasing greenhouse gases and other harmful emissions.
Myth #5:
The Drakes Bay fight is only about politics: It’s Democrats versus Republicans
Some contend that the fight over Drakes Bay is politically split along ideological fault lines. This too is untrue. First, there has been an outpouring of support from a community where most bi-partisan races were easily won in 75/25 percent split (Democrats/Republicans). Further, Democratic Senator Dianne Feinstein has been a staunch defender of Drakes Bay Oyster Company, as well as a fierce critic of the National Park Service and Department of the Interior. In addition to crafting legislation, Feinstein has been outspoken in her support, even writing a letter to Secretary Salazar last March that called on him to renew the lease. With demonstrated partisan support, this issue isn’t split along party lines.
Posted by Jane Gyorgy on January 23, 2013
https://oysterzone.wordpress.com/2013/01/23/01-23-13-dispelling-the-myths-about-the-dboc-conflict-with-the-nps/
I have an example of government doing exactly the opposite in removing Drakes Bay Oyster Farm from the Point Reyes National Seashore in California. The DOI, the NPS, and the CCC have committed their own style of deforestation by misinterpreting the law, re-writing history, and trampling California State’s Rights in so doing. Worse, the beacons of environmental preservation cannot see the forest for the trees in that they are now stating the opposite of their position in the establishment of the Point Reyes National Seashore in 1962, the opposite of their position in the passing of the Wilderness Act in 1976. Even the then PRNS Superintendent, Don Neubacher has done a 180 on his position in his letter Oakland Bank in 1998 where he stated he had every intention of continuing the oyster farm after it’s lease expired in 2012. It is as if they cannot see the forest for the trees! DBOC is a locally produced, sustainable, renewable source of protein production – 40% of CA oysters are produced there and they were the LAST oyster cannery in CA. Oyster Bay Wildlife Refuge on Long Island has a commercial oyster farm that produces 90% of New York’s oysters
If then why not now?
If there why not here in CA?
There is still hope with the lawsuit filed by the other oyster companies and businesses in the area who depend on Drakes Bay Oysters to stay in business.
For the legal documents, legitimate scientific reports and more go to http://www.OysterZone.org or http://savedrakesbay.com/core/
Oyster farming and wilderness are not mutually exclusive.